KEGG   Chlamydia psittaci CP3: B711_0868Help
Entry
B711_0868         CDS       T02251                                 

Definition
(GenBank) hypothetical protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF720
Motif
Other DBs
NCBI-ProteinID: AFS27257
Position
862277..862795
Genome map
AA seq 172 aa AA seqDB search
MWFSSTPLQANPRAAIEVPGTSITGGPNTATADEIIAKFAKDSNPLIITVYYVYQSVLVA
QDNLSIIAQELQANASAQTFLNNQEALYQYTTIPKNKLNDNSSAFLQDVQATNQAVGASR
QALQNQISGLGNGSQVISSNLNTNNNIIQQSLQVGQALIQTFSQIVSLIANI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtggttctcttctacaccactacaagctaacccaagagccgctatcgaggttccagga
acgtctatcacaggcggtcccaatacagcaacagctgacgaaattattgcaaaatttgct
aaagattccaatccgctgattattaccgtatactatgtataccaatcggtattggtcgct
caagacaacttatctattatcgctcaagaacttcaggctaatgcttctgctcaaactttt
ctaaacaaccaagaagctttataccaatacacaactatccctaaaaataaattaaacgat
aactcatcggcattcttgcaagatgttcaagcgacgaaccaagctgttggagcttctaga
caagcactacaaaaccaaatttcaggactaggaaatggctcccaagtgatttcaagtaac
ttgaataccaataataacattatccaacagtctctacaagttggtcaggctttaattcaa
acattctcacaaattgtgagcttgatagctaacatttaa

DBGET integrated database retrieval system