KEGG   Chlamydia psittaci CP3: B711_0878Help
Entry
B711_0878         CDS       T02251                                 

Definition
(GenBank) hypothetical protein
  KO
K11720  lipopolysaccharide export system permease protein
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc02010  ABC transporters
Module
cpsc_M00320  Lipopolysaccharide export system
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B711_0878
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpsc02000]
    B711_0878
Transporters [BR:cpsc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00320]
    B711_0878
 Other Transporters
  Pores ion channels [TC:1]
   B711_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptF_LptG CPP1-like
Motif
Other DBs
NCBI-ProteinID: AFS27267
Position
872635..873738
Genome map
AA seq 367 aa AA seqDB search
MYIWKRYVLTKFWFSLVSLIVLAFVFYASIHHSLHTIKGNTTSLASGASLKLSILYYLSQ
IALKAEFLIPQLVAVATTITLFSMQNKREVLLLQASGLSLKSLTAPLIHSSFIITLLLYA
NFQWLHPICEQISITKEHMDRGTLDKVHDKVPALYLKDQTVLLYSSIEQKTLTLNQVFWI
KNPKTIYTMEKLAFTTPSLPIGLDVIRFSETESGSIELSEYSDMKEFPEIEFGFYDNPFS
KIFTAGGKNRLSESFQAIPWNATGLGLSTTIPQRILSLLSTFYYMLISPLACISSMIISA
YLCLRFSRVPTVTLAYLVPLGTINTFFIFLKAGMVLSNSSVLPILPVMLFPLIILAIFTN
YAYAKLQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtatatttggaaacgttatgtattaaccaagttttggttttctttagtatcattaatt
gtattggcttttgttttttatgcctctattcatcactcccttcatactatcaaagggaat
actacctctctggcttcaggggcatcgttaaaactttctattctttattatctatcacag
atagctcttaaagcagaatttctcattccccagctagttgctgtggcaactaccatcact
ctattttcaatgcaaaataaacgtgaagtccttctcctacaagcctccggactctctttg
aagtctttaacagctcctttgatccattcgagttttattattacactacttttgtatgcg
aatttccaatggctacatcctatatgtgaacaaatatccataaccaaagagcatatggac
agaggcactctagataaagtccatgacaaagtccccgctctctatcttaaagatcaaaca
gttctactttattcttctattgagcagaaaacattaactcttaatcaggtgttttggatt
aaaaatcctaaaacgatctacaccatggaaaaactggcatttacaacaccatctcttcct
ataggacttgatgttatacgcttttccgaaacagaatctggaagtatagagcttagtgaa
tactctgatatgaaagagttccctgaaattgaatttggattctacgataatcctttttct
aaaattttcacggccggaggtaaaaatcgcctttcggagtcgttccaagctattccttgg
aatgccacaggcttagggttatctacaactattcctcagcgaatcttatctttattgtct
acgttttactatatgctaatttctcctttagcttgcatatcctcgatgattatctctgcg
tatctttgtttaagattcagtcgtgttcctacagtgactcttgcctaccttgtaccttta
ggaacgataaataccttttttatcttcttaaaagcaggtatggttctgtctaacagtagt
gttttaccgatattacctgtaatgttattcccattaattatcttagctatattcacaaac
tatgcttatgctaagcttcaataa

DBGET integrated database retrieval system