KEGG   Chlamydia psittaci CP3: B711_0882Help
Entry
B711_0882         CDS       T02251                                 

Gene name
rplT
Definition
(GenBank) ribosomal protein L20
  KO
K02887  large subunit ribosomal protein L20
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc03010  Ribosome
Module
cpsc_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B711_0882 (rplT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cpsc03011]
    B711_0882 (rplT)
Ribosome [BR:cpsc03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    B711_0882 (rplT)
  Bacteria
    B711_0882 (rplT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L20 GSH-S_ATP
Motif
Other DBs
NCBI-ProteinID: AFS27270
Position
complement(877106..877471)
Genome map
AA seq 121 aa AA seqDB search
MVRATGSVASRRRRKRILKQAKGFWGDRKGHFRQSRSSVMRAMAFNYMHRKDRKGDFRSL
WIARLNVASRINGLSYSRLINGLKCAGIDLNRKMLSEMAIHNPAGFAEVANQAKKALEAN
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtgagagcaacaggttcagtagcttccaggcgccgtcgtaagcgtatattaaaacaa
gctaaaggcttttggggagatagaaaaggccattttcgtcaaagccgatcctcagtaatg
agagctatggcgttcaattatatgcatagaaaagatcgtaaaggtgacttccgtagcctt
tggattgctcgtcttaacgtcgcttctagaataaacggtttatcctatagtcgtttaatt
aatggcttaaagtgcgcaggaatcgatttaaatagaaaaatgctatcagaaatggctatt
cataaccctgcgggttttgcagaagtggctaatcaagctaaaaaagctttagaggcaaat
ctttag

DBGET integrated database retrieval system