KEGG   Chlamydia psittaci CP3: B711_0883Help
Entry
B711_0883         CDS       T02251                                 

Gene name
rpmI
Definition
(GenBank) ribosomal protein L35
  KO
K02916  large subunit ribosomal protein L35
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc03010  Ribosome
Module
cpsc_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B711_0883 (rpmI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cpsc03011]
    B711_0883 (rpmI)
Ribosome [BR:cpsc03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    B711_0883 (rpmI)
  Bacteria
    B711_0883 (rpmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L35p
Motif
Other DBs
NCBI-ProteinID: AFS27271
Position
complement(877490..877684)
Genome map
AA seq 64 aa AA seqDB search
MPKMKSNKSVAARFKLTGSGQLKRTRPGKRHKLSKKSSQEKRNLSKQPLVDKGQVGMYKR
MMLV
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatgaaaagcaataagtccgttgcggcgcgttttaagttgacaggttctggc
cagttaaagagaactcgcccaggcaagaggcataaattatcgaaaaaatcttcgcaggaa
aaacgcaacctatctaagcagcctttagtagataagggacaggtaggtatgtataagcga
atgatgcttgtttaa

DBGET integrated database retrieval system