KEGG   Chlamydia psittaci CP3: B711_0901Help
Entry
B711_0901         CDS       T02251                                 

Definition
(GenBank) hypothetical protein
  KO
K06890  uncharacterized protein
Organism
cpsc  Chlamydia psittaci CP3
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    B711_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bax1-I
Motif
Other DBs
NCBI-ProteinID: AFS27288
Position
complement(897506..898219)
Genome map
AA seq 237 aa AA seqDB search
MGLYDRDYAQESRLPGTFTSRVYGWMTAGLAVTTFVSLGLYFSGMYRSLFSFWWVWCIAT
LGVSFYINAKIHKLSVPAVMGLFLAYSALEGLFFGTLVPVYAAQYGGGIVWAAFGSASLI
FGLSAAYGAFTKSDLTQMSSILMFALIGLMLVSVIFGVASIFVYMPLFYLLICYLGLAIF
VGLTVVDAQAIRRAAQNVGNDGDLSYKLSLIMALKMYCNVIMIFWYLLQIFSSSKRN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgggactatacgatcgcgattatgcacaagaatctcgtttgccgggaacgtttacatcc
agagtgtatggttggatgactgcgggtcttgctgtcacgacttttgtatcattaggatta
tacttttctggaatgtatagaagtttattttcgttctggtgggtttggtgcatcgctact
cttggagtatcgttctacattaacgctaagattcataagctttctgttcctgcagttatg
ggacttttcttagcatattccgctttggaaggattattttttggaactttagttcctgta
tatgccgcgcaatatggtggaggtattgtttgggctgcttttggatccgccagtttgatt
ttcggtttgtcggcagcttatggagcttttactaaaagtgatctcacgcagatgagtagc
attttgatgtttgctctgatcggtttgatgttggtttccgttatattcggggtggcttct
atatttgtttatatgccgctattctacctattaatttgctatttaggactagccattttt
gtaggattaactgtcgtagacgcgcaagctatccgtagagcggctcaaaatgtaggcaat
gatggtgatttaagctataagctatctttaatcatggcattaaagatgtattgcaatgtg
attatgatattttggtaccttctgcaaattttctcttcctcaaaaagaaactaa

DBGET integrated database retrieval system