KEGG   Chlamydia psittaci CP3: B711_0906Help
Entry
B711_0906         CDS       T02251                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00540  Lipopolysaccharide biosynthesis
cpsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    B711_0906 (lpxB)
Enzymes [BR:cpsc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     B711_0906 (lpxB)
Glycosyltransferases [BR:cpsc01003]
 Polysaccharide
  Bacterial polysaccharide
   B711_0906 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:cpsc01005]
 Lipid A
  B711_0906 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB LAB_N Kei1 Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: AFS27293
Position
904657..906540
Genome map
AA seq 627 aa AA seqDB search
MFPLYLVRILYPIGLIANVFFGFAFTIQWFLSERHKKAYVPKAFWIFSSIGAILMITHGF
IQSQFPIALLHGANLVIYFRNLNISSSRKLSLKTTLIILAVTLLLTALPFAIEAYYHPNM
QWMASPNIFHLPLPPPNIYWHIIGCFGLFTFSCRFFIQWCYLEMNNQSTLPALFWQVGFV
GGFLAFLYFIRTGDPVNILSYGCGLFPSIANLRIIYKKSRLSEFHNPSYFISAGEASGDT
LGSDLLRHIKALNPDQRCFGVGGPLMRKEGLEPLIHMEEFQVSGFLEILTSIFTLVKKYR
KLYKAVLKENPEIVFCIDFPDFHFFLIKKLRKCGYTGKIVHYVCPSIWAWRPKRKKILEK
YLDTLLLILPFENELFTDSPLKTIYLGHPLVKTISNFQHCASWKQELAISDQPIVALFPG
SRPGDILRNLQVQIRAFLASSLEESHQLLISSYNPKHDQTILDLLEKEGCRGKIVPEMFR
YHLMRDCDCALAKCGTIVLEAALNQTPTIVTCLLRPFDSFLAKYIFKIFMSAYSLPNIIT
KSIIFPEFIGGKSDFTPEEVAAAIDILANPKSKEKQKLACQKLLETMKTNVVTIQECLQT
IYSLNSRFHRENGCLGNYVQKNVRPSF
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctctttatctggttcgcatactgtatcctataggattaatagccaatgtattt
tttggctttgcgtttaccatccagtggtttctaagtgaaagacacaagaaagcttatgtc
cctaaagctttttggattttttcctcaataggggcgattttaatgatcacccatggcttt
attcaaagtcaatttcctatagcacttctccacggagcaaatctagttatctattttagg
aacctaaatatttcttcttcccgtaagctctctttaaaaaccactttgatcattcttgct
gtaacgttgcttctcactgcattaccttttgccatagaagcttactatcatcctaatatg
cagtggatggcttctcctaatatctttcaccttcctctacccccaccaaatatttattgg
catattattggttgtttcgggttgttcactttttcgtgtaggttctttattcaatggtgc
tacttagaaatgaataatcaatctacattgccggcgctattctggcaggtaggttttgtg
ggaggtttcctggcctttctttattttatacgcacaggagaccctgtaaatatcctcagt
tatggttgtggactctttccctccatagcaaatctacgcatcatatataagaaatcacgt
ctttcggagtttcacaaccccagctacttcatatctgcgggagaagctagtggtgacact
ttaggcagcgaccttcttcgccatatcaaagctcttaatcctgatcagcgttgttttggt
gttggaggacctttaatgcgcaaagaaggtcttgagcctctaatccacatggaagagttc
caagtgtcaggcttcttagaaatcctaacctctatcttcactctagttaagaaataccga
aagctatacaaagctgttcttaaagaaaatcctgagatagtcttctgcatagatttccca
gactttcattttttccttattaaaaagctaagaaaatgcggttatacaggaaaaatcgtt
cactatgtctgtccgagtatttgggcatggcgacctaaaagaaaaaagatcctagaaaag
tatttagatacacttttgctcatacttccttttgaaaatgagcttttcacagattctcct
ttaaaaacgatctatttaggacatcctttagtaaagacgatatcgaatttccaacactgt
gcatcctggaaacaagaactcgctatttctgatcaacctattgttgcgctatttccaggt
agccgacctggggatattctcagaaatttacaagtacaaattcgtgcatttcttgcctca
tcattagaggaatcacatcagcttctgatatcttcttacaacccgaaacacgatcaaacc
atcctcgatctcctagaaaaggaaggttgtcgtggtaaaattgtcccggagatgttccgt
tatcaccttatgcgagattgcgattgtgccttagcaaaatgtggaactattgtcttggaa
gccgctttaaatcaaacgcctacgattgtcacctgtcttcttcggccttttgatagcttt
ttagcaaagtatatctttaagatcttcatgtctgcatattcccttcccaatatcattacc
aaatcaattatcttcccagaatttataggaggtaaatctgactttactcctgaagaagta
gcagcagctatagatatccttgctaatcctaaatctaaagaaaaacagaaactggcgtgt
cagaaacttcttgaaacaatgaaaaccaacgttgtgacgattcaagaatgtttacaaact
atatactcgttaaacagtcgttttcatagagaaaatggttgcttaggaaactacgtccag
aagaatgttaggccgagtttttaa

DBGET integrated database retrieval system