KEGG   Chlamydia psittaci CP3: B711_0912Help
Entry
B711_0912         CDS       T02251                                 

Definition
(GenBank) incA family protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IncA Reo_sigmaC Filament LMBR1 Uds1 AAA_13 TMF_TATA_bd Spc7 EzrA HALZ NPV_P10 YabB DUF3450 Mod_r KLRAQ Cauli_DNA-bind Fez1 DUF4515 CREPT ADIP PCRF CCDC144C Laminin_II DUF1664 GAS CENP-F_leu_zip Rootletin Tropomyosin_1 Atg14 Phage_GP20
Motif
Other DBs
NCBI-ProteinID: AFS27299
Position
complement(910229..910975)
Genome map
AA seq 248 aa AA seqDB search
MMTSPVNTNPIATHVPTTQHALSSISASKYQRIATAIALLAGMVLIGTLIGALGFFALPT
SVTLVALVSTALLASVILLSMSMYNVVSQSRRVPGDARLGEENTRLQAEMIELREQLICS
EARLEEERGRCGELSVKLMSAIGDLAQANQEKASLESKVQALKELVASYPPIDEAAQKMQ
EELGKRTSEVALAKQNIGALEEQVQSLETQLTHSLEQVDALSAQKEELEACLQQLQDEEV
STVNHTAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgatgactagccctgtgaacactaatcctattgcgacacacgtacctacaacgcaacac
gctctgtctagcatatcagcgagtaaatatcaacgaattgcaactgctattgctttatta
gcaggcatggtgcttattggaactttaataggtgctttgggtttctttgccttacctaca
tctgtaactctagttgctcttgtatctactgctttactagctagcgttattcttctctcc
atgtctatgtataatgtagtttctcaatctcgaagagttcctggtgatgctcgacttggt
gaagagaacacacgtctacaggcagaaatgattgagctaagagagcagcttatatgttct
gaagcgcggttagaggaagaacggggacgttgtggtgaattgtcagtgaagttgatgagt
gccataggtgatttagcacaagcaaatcaagaaaaagcttctttagaatctaaagttcaa
gcactgaaggaattagtagcaagctatccacccatcgatgaagcagcacaaaaaatgcaa
gaagagctaggaaagaggacctcagaagttgctttggctaagcaaaacataggtgcttta
gaggagcaagtacaaagtttagaaacacaattaacacactctttagaacaagttgacgca
ctttcagcacaaaaagaagaattggaagcttgtttgcaacagttacaagacgaagaagtt
agcacagtaaatcacactgcaaggtaa

DBGET integrated database retrieval system