KEGG   Chlamydia psittaci CP3: B711_0912Help
Entry
B711_0912         CDS       T02251                                 

Definition
(GenBank) incA family protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Filament LMBR1 Uds1 AAA_13 Spc7 TMF_TATA_bd EzrA HALZ Mod_r NPV_P10 DUF3450 GAS KLRAQ Cauli_DNA-bind DUF4515 CCDC144C ADIP PCRF CREPT DUF1664 Laminin_II DUF4446 Tropomyosin_1 CENP-F_leu_zip DUF641 Phage_GP20 Rootletin
Motif
Other DBs
NCBI-ProteinID: AFS27299
Position
complement(910229..910975)
Genome map
AA seq 248 aa AA seqDB search
MMTSPVNTNPIATHVPTTQHALSSISASKYQRIATAIALLAGMVLIGTLIGALGFFALPT
SVTLVALVSTALLASVILLSMSMYNVVSQSRRVPGDARLGEENTRLQAEMIELREQLICS
EARLEEERGRCGELSVKLMSAIGDLAQANQEKASLESKVQALKELVASYPPIDEAAQKMQ
EELGKRTSEVALAKQNIGALEEQVQSLETQLTHSLEQVDALSAQKEELEACLQQLQDEEV
STVNHTAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgatgactagccctgtgaacactaatcctattgcgacacacgtacctacaacgcaacac
gctctgtctagcatatcagcgagtaaatatcaacgaattgcaactgctattgctttatta
gcaggcatggtgcttattggaactttaataggtgctttgggtttctttgccttacctaca
tctgtaactctagttgctcttgtatctactgctttactagctagcgttattcttctctcc
atgtctatgtataatgtagtttctcaatctcgaagagttcctggtgatgctcgacttggt
gaagagaacacacgtctacaggcagaaatgattgagctaagagagcagcttatatgttct
gaagcgcggttagaggaagaacggggacgttgtggtgaattgtcagtgaagttgatgagt
gccataggtgatttagcacaagcaaatcaagaaaaagcttctttagaatctaaagttcaa
gcactgaaggaattagtagcaagctatccacccatcgatgaagcagcacaaaaaatgcaa
gaagagctaggaaagaggacctcagaagttgctttggctaagcaaaacataggtgcttta
gaggagcaagtacaaagtttagaaacacaattaacacactctttagaacaagttgacgca
ctttcagcacaaaaagaagaattggaagcttgtttgcaacagttacaagacgaagaagtt
agcacagtaaatcacactgcaaggtaa

DBGET integrated database retrieval system