KEGG   Chlamydia psittaci CP3: B711_0917Help
Entry
B711_0917         CDS       T02251                                 

Definition
(GenBank) incA family protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemX
Motif
Other DBs
NCBI-ProteinID: AFS27304
Position
complement(915205..916644)
Genome map
AA seq 479 aa AA seqDB search
MKCVSPCFYLKSENSEDRCCNFSDSRVHVLTTIISLIASLLIITGAIAAVVLFGTQLGVL
YSTVIIGISVAIGVLLFSASLKCFSCHAVISQSQRFSEDTPRSHIHDSRPSEAPALTEES
IDAIERELRTLMSEHEQERLNHQYFVSQRDLAKISMDSAREEFDNAYTDFQRFQELLIVG
DCGNLGSDCQESLSRLREKSLNYARSLQCYEDLLQQLHSHQDLIDFRKIAPVHEKVRILM
QARDEAQTRIRSLEDALSLRNRDFAALSSMESDLQSSIEKLQNTQTVNQGTIRALQMRLE
EVGQNRDSLAEAPFLVIGGGAEEHIRETLLSGNALNVHALEEENQKLKRTPALYYRIMER
VETRFGSQYHSMLMENSMSPSFLILEESEEYTREEVGAMIASYFDHERESQQKELLRLRE
LTSQQTQEIANLRSEFSRLGNTVFEGTNLDTIDMSLEEDTVHNIVTAEDHFSDRGESRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtgtttctccttgtttctatttgaaatcggagaactctgaagatcgctgttgt
aatttttctgattctcgagttcatgttcttacgactattatatcattaatagcaagttta
ttgattattaccggagctatagctgctgtggttctatttggaacgcagttgggagtattg
tattctaccgtaattattggtatatctgttgctattggagtgttactcttcagcgctagc
ttaaaatgtttttcttgccacgctgtaatatctcagtcgcagcgtttctcagaagatacc
ccaagatctcatatccatgattctagaccctcagaagctccagctctcacagaggaaagc
atagacgccatagaaagagaattacgcacgttgatgtcagaacatgagcaagagcgcctc
aaccaccaatattttgtaagtcagagagacttagcaaaaatcagcatggatagtgctagg
gaggagtttgataacgcatatacagattttcaaaggttccaagagcttcttatagtcggg
gactgtggtaacctaggcagcgactgtcaagagagcctgtctagactcagagaaaaaagt
ctaaactatgcgcgttctctacagtgttatgaggatcttcttcagcaactgcactctcat
caggatctcattgatttccggaaaattgcccctgtacatgagaaagtgcgcattttaatg
caagcgagggatgaggcacaaacgcgtatacgttctttagaagatgcgttaagtctacgc
aatagggatttcgctgccttatctagtatggaaagcgatttgcaaagttcaatagaaaaa
ctacagaatacccaaacagtaaatcaagggacaatacgtgctttgcaaatgcgtttagaa
gaagtagggcaaaatagagatagtctggcagaagctccatttttagtcataggcggagga
gctgaagagcatatcagagaaacattattatcaggtaatgctctaaatgtacatgccctt
gaagaggagaatcagaagctcaagcgtacaccagctctttattataggataatggaaagg
gtggaaacacgttttggatcacaataccattccatgcttatggagaattcaatgagtccg
agttttttgatactagaggagtccgaggaatatactcgagaagaagtcggggctatgata
gcgagttattttgaccatgaaagagaaagtcaacaaaaagaactcctacgattgagagaa
ctcacttctcaacaaactcaagagatagcgaatttgcgaagtgagttctcaagattaggg
aataccgtttttgaaggtactaacctagatactatcgatatgagtttagaagaagatacc
gttcacaacatagtgactgccgaagatcatttttcagatcgcggtgaatctagagaataa

DBGET integrated database retrieval system