KEGG   Chlamydia psittaci CP3: B711_0918Help
Entry
B711_0918         CDS       T02251                                 

Definition
(GenBank) hypothetical protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFS27305
Position
complement(916765..916947)
Genome map
AA seq 60 aa AA seqDB search
MTNDENKQNNKKTKEFLQNQWDNVVLKISSAVLFILSLFTFLNFTFSLKNTLFSIIVLFF
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgatgaaaataagcaaaacaacaagaaaacaaaggaatttcttcaaaatcag
tgggataatgttgttctgaaaatctcttctgctgttctttttatacttagtttgtttacc
tttctaaatttcacattttccttaaaaaacacacttttctcaatcattgttcttttcttt
tga

DBGET integrated database retrieval system