KEGG   Chlamydia psittaci CP3: B711_0924Help
Entry
B711_0924         CDS       T02251                                 

Definition
(GenBank) fatty acid synthesis family protein
  KO
K03621  glycerol-3-phosphate acyltransferase PlsX [EC:2.3.1.15]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00561  Glycerolipid metabolism
cpsc00564  Glycerophospholipid metabolism
cpsc01100  Metabolic pathways
cpsc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    B711_0924
   00564 Glycerophospholipid metabolism
    B711_0924
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cpsc01004]
    B711_0924
Enzymes [BR:cpsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     B711_0924
Lipid biosynthesis proteins [BR:cpsc01004]
 Phospholipid acyltransferase
  GPAT
   B711_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_synthesis
Motif
Other DBs
NCBI-ProteinID: AFS27311
Position
complement(927962..928885)
Genome map
AA seq 307 aa AA seqDB search
MGGDHSPLVIWEVLIDVLNSRASNSHISFTAFASNEVKEQILSKNTYRGYPEVIASESFI
TMEDSPLSAIRKKSSSMALGLDYLKEGKIDAFISTGNTAALITLSRTKIPMFPTVRRPAL
LVRVPTLRGYAVILDVGANVSVNPEEMLGFARMGLAYKQCLGGTEHPTIGLLNIGSEERK
GTEAHRLTFRLLRETFQQAFLGNIESGDVFNGRVDVVVSDGFTGNIFLKTAEGVFDFLSH
ILGDKLESDVKRQLDYTIYPGSMVCGLSKLVIKCHGKACGRSLFNGISGSIDLVRARVCE
RILSSLS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgggaggagaccactctcctctcgttatttgggaagtgctaatcgatgtactcaactct
agagcttcgaactcgcacatttcttttactgcttttgcttctaatgaagtgaaggagcag
atactcagtaagaatacttataggggatatccagaggtaatagcttcagaaagctttatc
actatggaagattctcccttatccgctattcgcaaaaagtcttcatccatggctctgggt
ttagactatctcaaagagggtaagatagacgcatttatttctacaggaaacactgcggct
ttgattaccttatcacgaactaaaattcctatgttccctacagttcgtcgtcctgcttta
ctcgttcgtgttcctactctgcggggatatgcagttatattagatgtcggtgctaatgtt
tctgtaaatcctgaagagatgttaggttttgctcgtatgggtttagcctacaagcaatgt
ctgggaggtacagagcatcccacgataggtttattaaatattggttcagaagaacgtaaa
gggacagaagcgcacagactgacatttcgtttattgagggaaacatttcagcaggccttt
ctaggcaacattgaaagcggtgatgtcttcaatggtcgtgtggacgttgttgtttcagat
gggtttacaggaaacatcttcctgaaaacagcagaaggcgtttttgattttctcagtcat
atcttaggggataaattagagtctgatgtgaaacgtcaattagactatacgatttatcca
ggttccatggtgtgtgggctatctaaacttgtcataaaatgccacgggaaggcttgtggc
cggtctttgtttaacggaatctctggatccatagatttggttcgagcacgtgtctgcgag
cgaattttatctagcctttcttag

DBGET integrated database retrieval system