KEGG   Chlamydia psittaci 01DC12: BN356_0661Help
Entry
BN356_0661        CDS       T02343                                 

Definition
(GenBank) putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cpsd  Chlamydia psittaci 01DC12
Brite
KEGG Orthology (KO) [BR:cpsd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BN356_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCO01587
Position
74794..76074
Genome map
AA seq 426 aa AA seqDB search
MLALLIFVLLCGFYTSWNIGANDVANAVGPSVGSGVLTLRQAVVIAAIFEFLGALFLGDR
VAGTIESHIVSVSDPLIASGEYVYGMTGALLATGVWLQLASYFGWPVSTTHSIVGAVIGF
GLVLGKGTVIYWGSIGAILVSWVISPLMGGCIAYTIFSFIRRNILYKNDPVGAMIRIAPF
LAAFVFVVLGIIIVCGGVVTRLIPLPWALALVFLVGSIAYAIMFKYVHTPHCSFISASPK
SGSLLCRLKTCGGNYGRKYLIVERIFAYLQIIIACFMAFAHGSNDVANAIAPVAGVLRQV
YPQVYSSYTLIGLMAFGGVGLIIGLSIWGWRVIETVGCKITELTPSRGFSVGLSSAVTIA
LASAIGLPISTTHVVVGAVLGIGLARGIHAINLNIIKDIIMSWFITLPAGAVLSVLFFFA
LRALFQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccttactcatttttgttctcttatgtggtttctacacctcttggaatatagga
gctaacgatgttgctaatgctgttggccccagtgtaggatccggagtattaacactacga
caagctgtagtcattgccgctatttttgaatttttaggagcgttattcctaggagatcgt
gtagcaggaaccatagaaagtcatattgtttctgtttcagatcctttaatagcttctggg
gagtacgtttatgggatgacaggagccttgttagctacaggagtttggctacaattggcc
tcctattttggatggccggtctctacaacccattctatagttggagcggtgataggtttt
ggtctcgtccttggaaaaggaacagtaatttactggggatctataggggcgattttagtt
agttgggtaatctctccattaatggggggatgcattgcctatacaatcttctcttttata
cgtaggaatattctttataagaatgaccccgtaggagcaatgattcgcatagctcctttt
cttgctgcttttgtcttcgtcgttttagggattattattgtttgcggaggggtagtcacc
cggttgattcctttaccctgggctttggcattagtgttcttagtcgggagtattgcttat
gcaattatgtttaaatatgtgcatacgccacactgttcttttatttctgcttctcctaaa
tcagggagtttactttgtcgtttaaaaacatgcggaggaaactacggtagaaagtatctc
atcgtagaaagaatctttgcttacttacaaattattatcgcatgttttatggcttttgct
cacggatctaatgacgttgctaatgccatagctccggttgctggagttttacgacaggta
tatcctcaagtatattcttcctatacgttaatcggtcttatggcgtttggtggtgtggga
ttgatcatagggttatctatttggggatggcgagtaattgaaaccgtaggatgtaagatt
acagaactcacaccttcaagagggttttctgtaggtttaagttctgctgtgaccattgct
ttagcttcagctataggtttacccatatcaacaacacatgtagttgtcggagctgtctta
ggtataggcttagctcggggtatccatgcgattaatttaaatattattaaagacattatc
atgtcgtggtttatcactcttccagcaggagcagttctctctgttctatttttctttgct
ttaagagcgctcttccagtaa

DBGET integrated database retrieval system