KEGG   Corynebacterium pseudotuberculosis 48252: CPTA_01576Help
Entry
CPTA_01576        CDS       T03482                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cpse  Corynebacterium pseudotuberculosis 48252
Pathway
cpse00030  Pentose phosphate pathway
cpse00480  Glutathione metabolism
cpse01100  Metabolic pathways
cpse01110  Biosynthesis of secondary metabolites
cpse01120  Microbial metabolism in diverse environments
cpse01130  Biosynthesis of antibiotics
cpse01200  Carbon metabolism
Module
cpse_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cpse_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CPTA_01576
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CPTA_01576
Enzymes [BR:cpse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     CPTA_01576
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     CPTA_01576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH 3HCDH_N F420_oxidored ApbA NAD_binding_11 NAD_Gly3P_dh_N 2-Hacid_dh_C adh_short Epimerase
Motif
Other DBs
NCBI-ProteinID: AIG07405
Position
complement(1646463..1647920)
Genome map
AA seq 485 aa AA seqDB search
MTDQSNLAQIGVVGLAVMGSNLARNFAHKGHTVAVYNRSAAKTHTLMQEHGSEGNFIPSE
TIEEFVASLEKPRRAIIMVQAGAATDAVINQLADAMEPGDIIIDGGNSLYTDTIRREKEI
AARGLNFVGAGISGGEEGALNGPSIMPGGPAESWDALGPLLESISAVVDGTPCVTHIGPD
GAGHFVKMVHNGIEYADMQVIGEAYQLLRYAAGMEPAEIAEIFKTWNKGDLDSYLIEITA
EVLSQVDAETGQPLIDVIVDAAGQKGTGRWTVKAALDLGIPVTGIGEAVFARALSGAAKQ
RAATIGSLPSGTLLTLDKLDTDKETFVEDVRRALYASKLVAYAQGFDEIQAGSEEHDWSV
DPRDLATIWRGGCIIRAKFLNRIREAYDADSSLPSLLLDPYFKAELGGLVDSWRRVVVAA
TQLGLPVPVFTSSLSYYDSLRAERLPAALIQGQRDFFGAHTYKRVDKEGTFHTQWSGDRS
EIETS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcaatccaacttggcacaaatcggagttgtcggacttgcggtgatgggatca
aacctcgctcgtaattttgcacataaaggacacaccgtagctgtctataaccgcagcgct
gcaaaaacccacacgttgatgcaggaacacggctctgaaggaaatttcattccttcagag
acaattgaggaattcgttgcttcgttggagaaaccgcgccgggcaatcatcatggttcag
gcaggtgctgctactgatgctgtaatcaaccaactggcagacgctatggaaccaggcgat
atcattatcgacggtggtaattccttgtacacggacacaatccgtcgagaaaaagaaatt
gccgcacgcggtctcaactttgtaggcgcaggaatctcaggcggcgaagaaggtgctctt
aatggcccatccatcatgccaggaggtccagcagagtcgtgggatgcactaggtcctctc
ttagaatccatctctgccgtcgtcgatggaactccttgcgtaactcacatcggtccagat
ggcgcagggcactttgtcaagatggttcataatggaatcgaatacgctgacatgcaggtc
attggcgaggcttatcagttactgcgctatgcagctggtatggaacctgcggaaatcgct
gagattttcaagacttggaataagggcgaccttgactcgtatctcattgagattaccgct
gaggtgctatcccaggttgatgcagaaactggtcaaccacttatcgatgttatcgtcgat
gctgccggacagaaaggaacgggccgctggactgtaaaggcagcgctcgacttaggaatc
ccggtaacaggtatcggagaagccgttttcgctcgtgccctctctggagcagccaagcag
cgcgctgcaactattggaagcctcccttccggaacgcttcttaccctagacaagctagac
acagacaaagagacatttgtagaggatgttcgtcgtgcgctgtacgcatctaagcttgtt
gcatatgcccagggatttgatgagatccaggccggctccgaagagcacgattggtctgta
gaccctcgagacttagctacaatttggcgcggcggatgcattattcgagcaaaattcctc
aatcgtatccgtgaggcttacgacgcagactcgtctctgccgtcgcttcttctagatccc
tatttcaaagctgagcttggtggtcttgtagattcctggcgtcgagtggttgtcgctgcc
actcagctaggtcttcccgtcccagtttttacttcttcactttcctactacgattcgctt
cgtgcagaacgtttacctgcggcactcattcagggacagcgcgatttcttcggcgcccac
acatataaacgagtggataaagaaggcacgttccatacgcagtggtccggagaccgtagc
gagattgaaacgtcttaa

DBGET integrated database retrieval system