KEGG   Corynebacterium pseudotuberculosis 48252: CPTA_01596Help
Entry
CPTA_01596        CDS       T03482                                 

Definition
(GenBank) Cobalt-precorrin-6y C5-methyltransferase / Cobalt-precorrin-6y C15-methyltransferase [decarboxylating]
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
cpse  Corynebacterium pseudotuberculosis 48252
Pathway
cpse00860  Porphyrin and chlorophyll metabolism
cpse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpse00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPTA_01596
Enzymes [BR:cpse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     CPTA_01596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Methyltransf_2 Methyltransf_25 PCMT MTS
Motif
Other DBs
NCBI-ProteinID: AIG07425
UniProt: A0A4U9Q8P0
Position
complement(1669204..1670472)
Genome map
AA seq 422 aa AA seqDB search
MSREATSLRRIAVGDSVAKTGFITVVGISAGGVDELGTQAREALYQADIIIGSWRQLGLV
PEDVSAERRPWPSPMLPKIPEIFAELTDLNVVVLGSGDPMFHGIGSTLIRLLPQHSVTVI
PHSSSASLACARLGWPLDKTPVYSLVTNAVDHLVLPIQRGGIFLVLGQDEKTPASICDLL
VELNQSDAKIIILSDLGSSDEVVVSGTAEQPPTATSSLNVIAVSLQRKGESMLPGLADAH
YISDGQLTKRHIRALTLSTLAPRQGETLWDIGGGSGSIAIEWLRSTPGTTAVCFEVVEER
RNRIAKNARSLGVIDRLTILHGAPDSFDEVPTPPDAMFIGGGLTAPGVFDAAWSRLPMGG
RLVANAVTIESESVLWELRKTLGGSMARFDISQEHNVGSFTTMKPALPVLQWSVTKSNTP
KL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagtagggaagcgacctcgttacgacgcattgcggtaggggattcagtggccaaaact
ggttttatcactgtggtaggtattagcgcgggtggagtagacgagttagggacccaggcg
cgtgaagcactctaccaggcggacatcatcattggttcttggcgtcagctaggactcgtc
cccgaggatgtctcagcggaacgtcgcccgtggccgtctccgatgcttcccaaaatccca
gaaatttttgcagagctgacagatcttaatgtagtggtgttaggctcaggcgatccgatg
ttccatggcatcgggtcaacgctcatacggttgcttccgcagcattcggttacagtgatt
ccacatagctcctcagcatccttggcatgcgcgcgtctaggctggccccttgataagact
cccgtttatagcttggtcaccaacgctgtagatcatctagtacttccaatacaacgcggg
ggaattttcctggtgctcggtcaggatgaaaaaactcctgcttctatctgtgacctgtta
gttgagctcaatcaatcagacgcaaaaataataatactcagcgatttgggcagctctgat
gaggtagttgtttcaggcacggcagagcagccgcctacggctacgagctccctcaacgtt
atcgctgtgtccctgcagcgcaaaggcgagagtatgcttccggggcttgccgacgctcac
tatatctccgatggacagctcactaaacgccatattcgtgcccttacgctatcgactttg
gccccacgccaaggcgaaacgttatgggacataggtggtggttctggttctatcgctatt
gagtggctgagatccacacctggaacaacggctgtgtgctttgaagtcgttgaggaacgc
cgcaaccgcatcgcaaaaaatgcacggtcgttaggagttatagaccgcttaaccatcctt
catggagctcctgactctttcgatgaggtccctacgcctccagatgccatgttcatcgga
ggcggcctcacggcgcctggggtctttgacgctgcatggtctaggcttccgatgggtggc
cgtcttgtggctaacgcagtgacaatagaaagtgaatcggtgctctgggagttaagaaaa
acactgggtggaagcatggcccgcttcgatatttcgcaggaacataacgtgggatctttt
accacaatgaagccagcactgcctgtgctccagtggagtgttaccaagtccaacacccct
aaactttag

DBGET integrated database retrieval system