KEGG   Corynebacterium pseudotuberculosis 48252: CPTA_02022Help
Entry
CPTA_02022        CDS       T03482                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpse  Corynebacterium pseudotuberculosis 48252
Pathway
cpse00020  Citrate cycle (TCA cycle)
cpse00310  Lysine degradation
cpse00380  Tryptophan metabolism
cpse01100  Metabolic pathways
cpse01110  Biosynthesis of secondary metabolites
cpse01120  Microbial metabolism in diverse environments
cpse01130  Biosynthesis of antibiotics
cpse01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPTA_02022
  09105 Amino acid metabolism
   00310 Lysine degradation
    CPTA_02022
   00380 Tryptophan metabolism
    CPTA_02022
Enzymes [BR:cpse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CPTA_02022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl 2-oxoacid_dh E3_binding Biotin_lipoyl_2 GCV_H DUF2254
Motif
Other DBs
NCBI-ProteinID: AIG07851
Position
2131805..2134135
Genome map
AA seq 776 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FNEDDTVDVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVM
PELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDTV
DVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVMPELGESV
TEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDTVDVGDVIA
IIGEEGEAPAASDSDEKKEEPKQEAPKAEPTKEAPKGSGSSTDVVMPELGESVTEGTITQ
WLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGVLLEVRFNEDDTVDVGDVIAIIGEEGE
APAASDSDEKKEEPKQEAPKAEPTKEAPKEEPAKEAAKPVDNQNVPYVTPLVRKLANKYG
VDLNKVEGTGVGGRIRKQDVLAAAGQGSEPAQKEAPAAVKDPRANWSTKSVDPAKAELIG
TTQKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKDNKPAFIEKYGVNLTYLP
FFVKAVVEALVLHPNVNASYNAATKEITYHSDVNIAIAVDTERGLLTPVIHKAQELTLPE
IAQAIVDLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILVPPQVGILGTAAIQKR
PVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKDRLEKAKFQDDLNL
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcaccgagggaacaattacc
cagtggctcaagtctgtcggcgacaccgtcgacgtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttcccccgttgcgggcgttctgttggaggttcgc
ttcaacgaagacgacaccgttgatgtcggcgatgttatcgccatcatcggtgaggaaggt
gaggctcctgccgcaagcgattctgatgagaagaaggaagagccgaagcaggaagcaccc
aaggcagaacccaccaaggaagcacctaagggctccgggtcctccaccgacgtggtcatg
cctgagctgggcgaatccgtcaccgagggaacaattacccagtggctcaagtctgtcggc
gacaccgtcgacgtcgacgagccgttgctcgaggtttccactgacaaggttgacaccgag
gttccttcccccgttgcgggcgttctgttggaggttcgcttcaacgaagacgacaccgtt
gatgtcggcgatgttatcgccatcatcggtgaggaaggtgaggctcctgccgcaagcgat
tctgatgagaagaaggaagagccgaagcaggaagcacccaaggcagaacccaccaaggaa
gcacctaagggctccgggtcctccaccgacgtggtcatgcctgagctgggcgaatccgtc
accgagggaacaattacccagtggctcaagtctgtcggcgacaccgtcgacgtcgacgag
ccgttgctcgaggtttccactgacaaggttgacaccgaggttccttcccccgttgcgggc
gttctgttggaggttcgcttcaacgaagacgacaccgttgatgtcggcgatgttatcgcc
atcatcggtgaggaaggtgaggctcctgccgcaagcgattctgatgagaagaaggaagag
ccgaagcaggaagcacccaaggcagaacccaccaaggaagcacctaagggctccgggtcc
tccaccgacgtggtcatgcctgagctgggcgaatccgtcaccgagggaacaattacccag
tggctcaagtctgtcggcgacaccgtcgacgtcgacgagccgttgctcgaggtttccact
gacaaggttgacaccgaggttccttcccccgttgcgggcgttctgttggaggttcgcttc
aacgaagacgacaccgttgatgtcggcgatgttatcgccatcatcggtgaggaaggtgag
gctcctgccgcaagcgattctgatgagaagaaggaagagccgaagcaggaagcacccaag
gcagaacccaccaaggaagcacctaaggaagaaccggctaaagaggctgcaaagccagtc
gataaccaaaacgttccttatgtgaccccattggtacgcaagcttgctaataagtacggc
gttgacctcaataaggtcgaaggtaccggcgttggcggccgtatccgtaagcaagacgtt
ctcgccgcagccgggcaaggatctgagccggctcaaaaagaagcccctgctgctgttaag
gatcctcgcgctaactggtccaccaagagcgttgatcctgcaaaggcagagcttattggt
accacccagaaggtcaaccgcatccgcgagatcacggctaagaagatggtcgaggcattg
cagatttctgcacagctcacgcatcttcaagaggtggatatgaccaacgttgccacgctg
cgcaaggacaacaagccggcattcatcgaaaagtatggcgttaacctgacctacctgccg
ttctttgttaaggccgtggttgaggctctagtcctgcacccgaacgtgaatgcgtcttac
aacgctgccaccaaggagatcacttaccactccgacgtcaatattgcgattgcagtggat
accgagcgcggtctgctcacccctgtgatccacaaggcccaggagcttacgttgccggag
atcgctcaggctattgttgatctggccgatcgcgcccgtaacaataagctgaagccaaac
gacctatccggcgcaaccttcactgtgaccaatatcggttccgagggtgccttggcagat
accccaatcttggttccaccgcaggttggtatcttgggcaccgctgcgatccagaagcgc
ccagtggtaatcactgagaatggctcggacgccatcgcaatccgtcaaatgtgctacatc
ccgttctcttatgatcaccagatcgtagacggcgctgatgccggtcgcttcaccgcgacg
atcaaggatcgcctggaaaaggctaagttccaggacgacctcaacctctaa

DBGET integrated database retrieval system