KEGG   Corynebacterium pseudotuberculosis 48252: CPTA_02082Help
Entry
CPTA_02082        CDS       T03482                                 

Definition
(GenBank) Phosphoglycerate mutase family
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
cpse  Corynebacterium pseudotuberculosis 48252
Pathway
cpse00860  Porphyrin and chlorophyll metabolism
cpse01100  Metabolic pathways
cpse03030  DNA replication
Module
cpse_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cpse00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPTA_02082
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CPTA_02082
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cpse03032]
    CPTA_02082
Enzymes [BR:cpse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CPTA_02082
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     CPTA_02082
DNA replication proteins [BR:cpse03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     CPTA_02082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H ZT_dimer
Motif
Other DBs
NCBI-ProteinID: AIG07911
Position
complement(2189727..2190884)
Genome map
AA seq 385 aa AA seqDB search
MKVIIEADGGSRGNPGVAGSGTVLFDATHTEILRRLAYVVGTATNNVAEYHALLNGLTAA
RELGATEVDVLMDSKLVVEQMSGRWKTKHPDMKQLALSCQHIASGFASITYTWIPRNQNA
RADELANKAMDALAKGAQPGFLELGDQPQSAATSTDPAEEKDKCAGDRHATAPKTWNGAT
TEATRFLLLRHGQTPMSAARQYSGLSNPSLSDLGRYQAECAAQYFASRGGIDVIVASPLK
RCQETAAAVARSLRMSDIRTVDELREMDFGQWDGLTFSQAHESDPELHQQWLADPKIAPP
GGESLVQAHRRIKKAREELQREYGESTVLVVSHVTPIKSIVRQALDAPAGMFHRMHLDLA
SLSIAEFYSDGPTCVRLVNDTSYLR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcattattgaagcagacggaggctctcgcggaaacccaggtgttgcggggtct
gggaccgtgctttttgacgcaacccataccgaaattctgcgtcgattggcttatgtcgtg
ggcactgcgaccaacaatgttgcggaatatcatgccctcctgaacgggctgactgctgct
cgggagcttggagccacagaagtggatgttctcatggactctaaacttgtggtggaacag
atgtcgggacgctggaaaaccaaacaccccgacatgaaacagctcgctctttcttgtcaa
cacatagcttcaggatttgcgtctattacgtacacgtggattccccgtaatcagaatgcg
cgggcagatgagctggccaacaaggctatggatgctttggccaagggggcgcaaccggga
tttttggagctaggagaccagcctcaatccgcagcaactagcaccgatcctgcagaagaa
aaagataagtgtgctggagaccggcacgctactgcaccaaaaacgtggaacggggctact
acagaagccacccgattccttttgttacgccatggacaaaccccgatgtctgcggctcgc
caatacagcggactcagcaacccaagcctctctgacttagggcgatatcaagcagagtgc
gctgcccaatacttcgcttcccgtgggggaattgacgtgattgtggcatctccgctcaag
cgttgccaggaaacggcggcggcagttgcacgatctctcaggatgagtgatatccggacg
gtggatgagctgagagaaatggattttgggcaatgggatggtctgacttttagccaagcc
catgagtccgacccggagctgcatcagcaatggcttgcggaccccaagattgctcccccc
ggcggagaatcacttgtgcaggctcatcggaggatcaaaaaggccagggaagagctacag
cgtgaatatggggagtcgaccgtcctcgtggtcagccatgtaaccccaattaagtccatc
gtgcgtcaggctcttgatgctccagctgggatgttccatcgtatgcaccttgatttagcg
tctttgtccatcgcggagttttactcagacggccccacgtgtgttcgcctggtcaatgac
acgtcttatctacgctaa

DBGET integrated database retrieval system