KEGG   Corynebacterium pseudotuberculosis Ft_2193/67: CPTC_00898Help
Entry
CPTC_00898        CDS       T03484                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cpsf  Corynebacterium pseudotuberculosis Ft_2193/67
Brite
KEGG Orthology (KO) [BR:cpsf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CPTC_00898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF443
Motif
Other DBs
NCBI-ProteinID: AIG11186
UniProt: A0A515E2Y6
Position
917526..919130
Genome map
AA seq 534 aa AA seqDB search
MADSVMLTTPSTEDAGSDRWWHLTFGGLLAVTLLVFALWSFGYVGDTANKGILITTILFG
VFMAFNIGGNDVANSFGTSVGAGTLTMKQALIVAAIFEVSGAVLAGGEVTDTVKSGIVDL
DAIDLSPHHFAFIMMASLLGAAVWLLLATRMGWPVSTTHSIIGGIVGASLVLGFSQGLGG
WEMVQWGEIGQIALSWVLSPVLGGLAAWLLFGFIKKHILVYNEGADEQLRQIKADRIELH
KSFKASFERLNEIQQLAYTNAMTRDAALIQERDFDPSELESEYYRDLYRINHRRDNLNTH
QALENWVPLLAAGGAALIGAMMLFKGLKNLNLHISTLGNVLILGMVSAVVWMAVLIFSRT
LKQQELSRATFVIFSWMQVFTASAFAFSHGSNDIANAIGPFSAVLDALRTDSINGKAAVP
TALMITCGVALIAGLWFIGRYVIHTVGSGLTEMHPASGFSAELAAAAVVMGASVLGLPVS
STHILIGAILGIGIVNKAANWRLMKPIAMAWVITLPAAAFVSGVAVFVLNAVWG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcgttatgctgaccacaccatccactgaggatgcaggttcggatcgatgg
tggcatcttacgtttggtggacttttagcagtcacgctgcttgtttttgccctgtggtca
ttcggctatgtgggtgatacggccaacaagggcattctgattaccacgatattgtttggc
gttttcatggccttcaatattggtggcaatgacgtggccaattcctttggaacttccgtg
ggggcaggtaccctcactatgaagcaggctctaatcgttgcggccatctttgaggtttct
ggtgcggttctcgctggtggtgaggttactgacacggttaaatccgggatcgtagacctt
gacgctatagatttaagcccgcatcactttgccttcattatgatggcctctcttctgggg
gcggcggtgtggttattgctagctacccgtatgggatggccagtgtccacaacccactcg
atcatcggcggcatcgttggagcttcccttgtactgggctttagtcagggccttggtggc
tgggagatggtgcagtggggggaaatcggccagatcgcattgtcctgggttctttctccc
gtgctaggtgggctggctgcgtggctgctgtttggctttattaaaaagcacatcctggtt
tataacgaaggcgcggatgagcaattgcgccagatcaaggctgatcgcattgagctgcat
aagtctttcaaggcctcttttgagcggttgaatgagatccagcagctcgcgtacacaaat
gccatgacgcgcgacgccgccttgattcaggagcgcgattttgaccctagcgagctagag
tccgagtactatcgcgacctctaccgtattaatcatcggcgcgataacctcaacactcac
caggcccttgagaactgggtgccgttgctcgctgcgggtggagcggctctgatcggcgcc
atgatgctctttaaggggctgaaaaatcttaacttgcacatcagcacgctggggaacgta
ctgatccttggaatggtctctgccgttgtgtggatggcggttttgattttttctcggact
ctcaagcagcaagagctttctcgtgcaacgtttgtcatattctcctggatgcaggttttt
acagcatcggcattcgccttctctcacggttccaatgacatcgctaatgcgatcggtccg
ttctctgcggtgcttgatgctctgcggaccgacagtattaacggcaaggcggcggttcct
accgcgctgatgattacgtgcggtgttgcgttgattgccggcctgtggtttatcgggcgc
tacgtgattcatacggtggggtcagggctaacggagatgcatccggcatccgggttctct
gctgagttggctgcggctgctgtggtgatgggggcctctgtccttggccttcctgtctcc
tctactcacattctgattggtgcaatcctaggtattggaattgtgaacaaggccgccaat
tggcgattaatgaagcccatcgcgatggcctgggtgattactcttccggctgcggccttt
gtgtcgggcgtggctgtgttcgtattaaacgctgtgtggggataa

DBGET integrated database retrieval system