KEGG   Corynebacterium pseudotuberculosis Ft_2193/67: CPTC_01118Help
Entry
CPTC_01118        CDS       T03484                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
cpsf  Corynebacterium pseudotuberculosis Ft_2193/67
Pathway
cpsf00561  Glycerolipid metabolism
cpsf00640  Propanoate metabolism
cpsf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CPTC_01118
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CPTC_01118
Enzymes [BR:cpsf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     CPTC_01118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AIG11406
UniProt: A0A2K8J9N2
Position
1148583..1149659
Genome map
AA seq 358 aa AA seqDB search
MSYSLQLPGYSIGKDAYGKIDEVIASYGYRAVVIGGKTAIEKTREAFEAAQEEQDFVIED
WVVYGHNSTYGNVDKLCSLESVRNAEVIFGVGGGRAIDTVKVVAARLEKPLFNFPTVGSN
CAAATNLSVMYKDDDSLEGYDYQPGPCQHVFINTAVIANSPVDLFWAGIADGMSKECEVK
LQSRGKELTNAPLMGRHLSSSVTPALMEYGFRALQDCKNARPSRAIEEVVLAIVMTCGYV
SNMTVDPGQTYYYNSALAHAFYNSTTAIPRCVGVHLHGEIVSYGVLALLQYDQDFERKDR
YVEFYKTMGFPLTLADLDLSESDVPAIMERVPTTTEWKVGEYDFGRFARAIIDAQVFN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactcgcttcaacttcctggctatagcatcggcaaagatgcgtatgggaaaatt
gatgaggtcattgcttcttatggataccgtgcagtggttatcgggggcaaaactgccata
gagaaaacccgtgaggcttttgaagctgcgcaagaagaacaagattttgttatcgaagac
tgggttgtttatgggcataattccacttatggcaacgtcgataagctatgcagccttgaa
tcggtgcgtaatgcagaggtgatctttggtgtcgggggcggccgggcgattgacacggta
aaggtcgttgcagcgcggttggagaagcctctctttaactttcccacggtgggttctaac
tgtgcagcggcaacaaacctctctgtgatgtacaaggacgacgattccctggaaggttac
gattatcagccggggccttgtcagcatgtgtttattaatactgctgtgatcgcgaattct
ccggtggacctcttctgggcgggtattgctgacgggatgtcaaaggaatgcgaagtcaaa
ttgcaatctcggggcaaagagttgactaacgctccgctgatgggacgtcacctgagttct
tctgtgactcctgcgctcatggagtatggcttccgggcgcttcaggactgcaagaatgct
cgcccctcaagagccatcgaagaagtggtcctggcaatcgttatgacttgtggatatgta
tccaatatgacggtcgatccagggcaaacctattattacaactctgcattggcgcatgct
ttttataactcgactactgcgataccccgttgtgtcggcgtgcatctccacggggagatc
gtttcctatggtgtgttggcgctgctgcaatacgaccaggatttcgagcgcaaagatcgt
tacgtggaattttataaaactatgggcttcccgttaactctcgcggatttggaccttagc
gaatctgacgtgccggcgattatggaaagagtcccgaccaccaccgagtggaaggttggg
gaatatgactttggtcggttcgcccgcgcgatcattgacgctcaagtttttaactag

DBGET integrated database retrieval system