KEGG   Corynebacterium pseudotuberculosis Ft_2193/67: CPTC_01221Help
Entry
CPTC_01221        CDS       T03484                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cpsf  Corynebacterium pseudotuberculosis Ft_2193/67
Pathway
cpsf00450  Selenocompound metabolism
cpsf00970  Aminoacyl-tRNA biosynthesis
cpsf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CPTC_01221
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CPTC_01221
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpsf01007]
    CPTC_01221
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpsf03016]
    CPTC_01221
Enzymes [BR:cpsf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CPTC_01221
Amino acid related enzymes [BR:cpsf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CPTC_01221
Transfer RNA biogenesis [BR:cpsf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CPTC_01221
 Prokaryotic type
   Other AARSs
    CPTC_01221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIG11509
Position
1254407..1256239
Genome map
AA seq 610 aa AA seqDB search
MTNRVLVSVAWPYANGPRHIGHVAGFGVPSDVFARYQRMAGADVLMVSGTDEHGTPLLVQ
ADKEGVSVKELADRYNRQIVEDLAGLGLSYDLFTRTTTRNHYSVVQELFKGLYENGYMIK
ETTMGAVSPSTGRTLPDRYIEGTCPICGADGARGDQCDNCGNQLDPADLINPVSKINGET
PQFIETEHFLLDLPALADALADWLKERQDWRPNVLKFSLNLLEDLRPRAMSRDIDWGIPI
PVEGWEDNGAKKLYVWFDAVVGYLSASIEWAYRIGKPDAWKEWWTDPAASSYYFMGKDNI
TFHSQIWPAELLGYQGKGARAGKLHTFGELNLPTEVVSSEFLTMSGSKFSSSKGIVIYVK
DFLREFGPDPLRYFIAVAGPENNDTDFTWDEFVRRVNNELANGWGNLVNRTVSMAYKNFG
EVPTPGELTESDQRILKLSAEAFEVVGDALAHSRFKQGITHAMHVVGEANAYIAEQEPWK
LAKDETQRERLATVLWTALQVVSDCNVLLTPYLPHISQQVHETLGRDGVWAAKPQIIEVA
DDMPVEPVGVGVPASGQTYPVIMGDYASQQARWARIDAIPGTSLSKPKPLIAKLDPELGE
TGPEWAPITR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgactaaccgtgtgctcgtttctgttgcttggccttatgccaatggacctcgccacatt
ggacatgtggcagggtttggtgtcccctcggatgttttcgctcgctatcagcgaatggcc
ggtgcagacgtgcttatggtctccggtacggatgagcacggtactccgcttttggttcaa
gcagacaaagaaggagtgtctgtcaaagaactcgctgatcggtataaccgacagatcgtt
gaagatctcgcaggcttgggactgtcctatgatctctttacccgtacaactacaaggaat
cattattcggttgttcaagagctctttaaagggctctatgaaaacggctacatgataaaa
gagaccaccatgggcgctgtttctccctccacagggcgcacgcttcctgatcgctatatt
gagggcacgtgccctatctgtggcgcggacggggcacgcggagatcagtgcgataattgt
ggaaatcaattggatccagcggatttgattaacccggtttcaaagatcaacggcgagacg
ccacagttcattgagactgagcatttcctccttgatcttcctgcactggcagatgctctg
gctgattggctcaaggagcgtcaggactggcgcccgaacgttctcaaattctccttgaat
cttttggaagacctgcgccctcgggctatgagccgtgatattgactggggaatccctatc
ccagttgaagggtgggaagacaacggcgctaagaaactctatgtttggttcgacgcggtc
gtcggttacttatctgcgtcgattgagtgggcatatcgcattggaaagccggatgcgtgg
aaagaatggtggactgatcccgctgcctcaagttattacttcatgggtaaagataacatc
actttccattctcagatctggccggctgagcttttggggtatcaaggaaagggcgctagg
gccggcaaactgcatacttttggggagcttaaccttcctacggaagtggtgtcttctgag
ttccttactatgtccggctctaagttctcttcctctaaaggcattgttatttatgtcaag
gacttccttagggaatttggtccagacccattgcgatatttcattgccgttgcggggcca
gagaataatgacaccgattttacgtgggatgagttcgtccgccgcgtaaacaacgagctg
gccaatggttggggcaaccttgtaaaccgcactgtttccatggcttacaagaatttcggt
gaggtgccaactccaggtgagctgaccgagtcggaccaacggattctcaagctttctgct
gaagcctttgaggttgttggggacgctcttgcacactcacgttttaaacaggggattacg
catgcaatgcatgtggtgggtgaagcgaacgcttatattgcggaacaagaaccatggaag
ctcgctaaagacgagactcagcgtgagcgcctagctacggttttgtggacggcgctgcaa
gtagtctcagactgcaatgtgctgttgactccctatctgccgcatatttcccagcaggta
catgagacgttgggccgtgacggcgtgtgggcggcaaaaccacagatcatagaggttgcc
gatgatatgcctgtggagcctgtcggcgtgggagttcctgctagcgggcaaacatacccc
gtgattatgggcgattatgcgtcgcaacaagcacggtgggcacgtatagacgccatcccg
gggacctctttgtccaagccaaagccgctgattgctaagttggatccggagctgggggag
acaggtccagaatgggcaccgattactcgctag

DBGET integrated database retrieval system