KEGG   Chlamydia psittaci MN: B599_0011Help
Entry
B599_0011         CDS       T02311                                 

Definition
(GenBank) exodeoxyribonuclease V gamma chain domain protein
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
cpsi  Chlamydia psittaci MN
Pathway
cpsi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpsi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    B599_0011
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cpsi03400]
    B599_0011
Enzymes [BR:cpsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     B599_0011
DNA repair and recombination proteins [BR:cpsi03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     B599_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma Ocnus
Motif
Other DBs
NCBI-ProteinID: AFS22036
Position
complement(13432..14106)
Genome map
AA seq 224 aa AA seqDB search
MNATKHSQAIFSNSPIHLLAKLAEDLFSTYQQPFTKRWILVANTEIGHWLRRELTNATSN
HVFMGSTIFSSSDSLVKHLFTEVCHEKPLIPDYITLPLFIYDLLKTSEATPDILQNTSFL
SEPSYSSTKHLASIFKKFYTFSQAPSENSRYHKDLFSQLEKHFTPMGKVFASILSSIKAK
KQNRSLHIFGYSHLPKHFATFFYGVELFFPCIFLLFFTKSRIFW
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgaccaaacatagtcaggcaatttttagcaactcccccattcatctattagct
aaacttgcagaagatctattttctacttatcaacagccatttactaaaaggtggattctt
gttgccaatacagaaatagggcactggctacgtagagaacttactaatgctacgagtaac
cacgtttttatggggtcgactattttctcttcttctgactcccttgtcaaacatttattc
actgaagtttgtcatgaaaaacctttaattcctgactatataacacttcctctatttata
tacgatctactaaagacttccgaagcaactcctgatattttacaaaacacatcttttctt
tcggagccttcttatagctcaacaaagcatctggcatctatttttaaaaaattctataca
ttctcgcaagcgccttcagaaaatagtcgttatcataaagatcttttttctcagttagag
aagcactttacgcctatggggaaggtgttcgcttccatactatcttctataaaagctaaa
aaacaaaaccgttccttacacatctttggttattctcatttaccaaagcattttgcgact
tttttttacggagttgagttattttttccctgtatatttttactgtttttcaccaagtcg
cgaatattttggtga

DBGET integrated database retrieval system