KEGG   Chlamydia psittaci MN: B599_0251Help
Entry
B599_0251         CDS       T02311                                 

Definition
(GenBank) uroporphyrinogen-III synthase HemD family protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cpsi  Chlamydia psittaci MN
Pathway
cpsi00860  Porphyrin and chlorophyll metabolism
cpsi01100  Metabolic pathways
cpsi01110  Biosynthesis of secondary metabolites
cpsi01120  Microbial metabolism in diverse environments
Module
cpsi_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cpsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B599_0251
Enzymes [BR:cpsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     B599_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 ErmC
Motif
Other DBs
NCBI-ProteinID: AFS22062
Position
complement(240178..240843)
Genome map
AA seq 221 aa AA seqDB search
MTIYLGLNRETANRYHASFVPILEIIPFARSSPQLRYALRYLEETSHILLTSPSSTSLFI
SRMRRKNSKKTLSTKHYLCLGEITASRLTRLLPKAQYSPATIETGEGVLPMISSLPKNAR
ILYPHSALSRSVIEDFLKRENRSFFAYSHYTIRERQLHPSVFKQCSRVILTSPSGVRAYA
KLFPQLPRRIHICQGPITLKEFREIYNHPGELLQKDSLTES
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccatatacctaggattaaatcgagaaacagcaaacagataccacgccagcttcgtt
ccgattcttgagatcattccctttgcaagaagctctcctcaactacgttacgccctgcgt
tacctagaagaaacttctcatatcctgctcaccagcccatcttcaacatcactatttatt
tctagaatgcgcagaaaaaattctaaaaagacgttatctaccaaacattacctttgttta
ggagaaatcacagcaagtcgccttacaaggcttctcccaaaagcacaatattccccagct
actattgaaaccggagaaggcgtgctcccaatgatctcctctttacccaaaaacgctcgt
atcctctacccacactcagccttatcgcgttctgtaattgaagattttttaaaaagagaa
aaccgaagcttttttgcctattcccactacaccattcgagaacgtcaattacacccctct
gtattcaagcagtgcagccgtgtaattttaaccagtccctctggagttagggcgtatgct
aaactcttcccccagctcccaaggagaatacacatctgccaaggcccgatcacacttaaa
gaatttagggaaatttacaaccatcctggggaacttcttcaaaaggacagccttaccgaa
agctga

DBGET integrated database retrieval system