KEGG   Chlamydia psittaci M56: B602_0519Help
Entry
B602_0519         CDS       T02310                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpsm  Chlamydia psittaci M56
Pathway
cpsm00010  Glycolysis / Gluconeogenesis
cpsm00020  Citrate cycle (TCA cycle)
cpsm00620  Pyruvate metabolism
cpsm01100  Metabolic pathways
cpsm01110  Biosynthesis of secondary metabolites
cpsm01120  Microbial metabolism in diverse environments
cpsm01130  Biosynthesis of antibiotics
cpsm01200  Carbon metabolism
Module
cpsm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpsm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B602_0519
   00020 Citrate cycle (TCA cycle)
    B602_0519
   00620 Pyruvate metabolism
    B602_0519
Enzymes [BR:cpsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B602_0519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFS25283
Position
complement(533602..534888)
Genome map
AA seq 428 aa AA seqDB search
MISLLKMPKLSPTMEVGTIVKWHKNNGDKIEFGDVLLEVSTDKAVLEHTANEEGWFRDCL
VKEGTKVHIGTPIAVISSEKDEDFNLDTILPKTPEPELPVENVQLVEEEVTKVQPSVASM
QLAFQFKPEPPLSKPLSLKVDSSKSPISPLAKRVAKEKNLDISGIKGSGPGGRIVEKDLD
KAPTKGIAGFGYPEAPEVHPGSYHEETLSPIRDIIAQRLQAAKASIPHFYVTQKVYASPL
LALLKELQAQGIKLSINDCIVRACALALKEFPEVNSGFNSVDNKIVRFETIDISIAVAIP
DGVITPIVRCADRKNIGMISAEIKSLASKAKSQSLKEEEYKGGSFCVSNLGMTGITAFTA
IINPPQAAILAVGSVQEEPIVINGEILVGSTCILTLSIDHRVIDGYPAAMFMKRLQKILE
APSVLLLN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctctattaaaaatgccgaaactttctcccaccatggaggtaggaactatcgta
aaatggcataagaacaatggcgataaaatagagtttggtgatgttctcttagaagtatca
acagataaggctgtactcgagcacacggcaaatgaagaaggctggttccgggattgtctt
gttaaagagggaacaaaagtacacataggcacacctatagctgtcatatcttcggaaaaa
gatgaggatttcaacttagatactatccttcctaaaactcccgagccagaacttcctgta
gaaaatgttcaactagtggaagaagaagtcacgaaagtgcaaccatccgttgcctccatg
cagttagcctttcaatttaaacctgaacctcctctgtctaaacctctatctttaaaagta
gattcttcaaaatcccccatttctcccctagctaaacgtgtagcgaaggaaaaaaacctg
gatatttctggaatcaaaggtagcggtcctggcggacgtattgttgaaaaagacctggat
aaagctcctaccaaaggtattgcaggttttggttaccctgaagctcctgaagtgcatcct
ggatcctatcacgaggaaactctttctcctattcgagatatcattgcacagaggttacaa
gctgcgaaagcctctattccacatttttatgtaacacaaaaagtttatgcttcgccgttg
ctcgccctgcttaaggaactacaggcccaaggaattaagctgtctattaatgactgtatt
gttcgtgcttgcgccctagctttaaaagagtttcctgaagtaaattcaggcttcaatagc
gtcgacaataaaattgtacgttttgaaactatagatatttcgatagctgtggctattcct
gatggagtgattactcctattgtacgctgtgctgatcgcaagaacataggtatgatttct
gccgagattaaaagcttagcttctaaagcgaaatctcaatctttaaaagaggaagagtat
aaaggtgggtctttctgcgtttccaatttaggcatgacaggaattacagcattcacagca
attatcaatccccctcaagcagctattcttgctgtgggtagtgttcaggaagagccgata
gtaatcaatggagaaattctagttggttctacatgtatattgacattatctatagatcac
cgtgtaattgacggatatcctgcagcaatgtttatgaagcgattgcagaaaattttagaa
gctccttctgtccttttattaaattaa

DBGET integrated database retrieval system