KEGG   Chlamydia psittaci NJ1: B712_0342Help
Entry
B712_0342         CDS       T02252                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpsn  Chlamydia psittaci NJ1
Pathway
cpsn00010  Glycolysis / Gluconeogenesis
cpsn00051  Fructose and mannose metabolism
cpsn01100  Metabolic pathways
cpsn01110  Biosynthesis of secondary metabolites
cpsn01120  Microbial metabolism in diverse environments
cpsn01130  Biosynthesis of antibiotics
cpsn01200  Carbon metabolism
cpsn01230  Biosynthesis of amino acids
Module
cpsn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B712_0342 (tpiA)
   00051 Fructose and mannose metabolism
    B712_0342 (tpiA)
   00562 Inositol phosphate metabolism
    B712_0342 (tpiA)
Enzymes [BR:cpsn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B712_0342 (tpiA)
Exosome [BR:cpsn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B712_0342 (tpiA)
  Exosomal proteins of bladder cancer cells
   B712_0342 (tpiA)
  Exosomal proteins of melanoma cells
   B712_0342 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFS27862
Position
352904..353668
Genome map
AA seq 254 aa AA seqDB search
MERKRYIFGNWKMHKTAKEAKDYLSVFCPLLEEVAPVSRVGITPAFTALHACCESIKSFH
SPLWLGAQNVHQDTSGAFTGEISLPMLKEFDVNFVLLGHSECRHIFHEEDTTIALKVGAA
AREGIIPVLCIGETLEVREKGATEAMLSNQLMLGLAQLPETASVIIAYEPVWAIGTGKVA
SAVDVQEAHAFCREVLANIFSKEKAEEISILYGGSVKADNAEGFALCPDVDGLLVGGASL
DPKVFADVVANFHR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagcgttatattttcggtaattggaaaatgcataagacagctaaagaggct
aaagattatttgtctgttttctgccctctccttgaagaagttgctcctgtatctcgtgtg
ggtatcacccccgcattcacagcgttacatgcttgctgtgaatctataaagtcttttcac
agtcctctgtggctgggagcgcaaaatgtccatcaggatacctcgggagcctttacaggt
gaaatttccttgcctatgctcaaagaatttgatgtcaattttgtacttttaggtcactcc
gaatgccgtcatatttttcatgaagaagatacgaccattgcgcttaaggttggtgccgca
gctcgtgaaggcattattcccgttctgtgtatcggagaaactctagaagttagagaaaaa
ggcgcgacggaagctatgttatctaaccagttgatgttggggcttgcgcaacttccggaa
actgcctctgtaatcattgcttatgaacccgtatgggcaattggtacgggtaaagtagct
tcagcggttgatgtgcaagaggcacatgccttttgtcgagaggtgcttgcgaatatattt
tccaaagagaaagctgaggagatttccattctttatgggggatctgtaaaggcagataat
gctgaaggatttgctctttgtcctgatgtagacgggttgttagtaggaggcgcttcctta
gatcctaaagtttttgccgatgttgtcgcgaattttcatcgttag

DBGET integrated database retrieval system