KEGG   Corynebacterium pseudotuberculosis CS_10: CPTB_00302Help
Entry
CPTB_00302        CDS       T03483                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cpsu  Corynebacterium pseudotuberculosis CS_10
Pathway
cpsu00450  Selenocompound metabolism
cpsu00970  Aminoacyl-tRNA biosynthesis
cpsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CPTB_00302
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CPTB_00302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpsu01007]
    CPTB_00302
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpsu03016]
    CPTB_00302
Enzymes [BR:cpsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CPTB_00302
Amino acid related enzymes [BR:cpsu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CPTB_00302
Transfer RNA biogenesis [BR:cpsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CPTB_00302
 Prokaryotic type
   Other AARSs
    CPTB_00302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIG08358
Position
complement(323511..325343)
Genome map
AA seq 610 aa AA seqDB search
MTNRVLVSVAWPYANGPRHIGHVAGFGVPSDVFARYQRMAGADVLMVSGTDEHGTPLLVQ
ADKEGVSVKELADRYNRQIVEDLAGLGLSYDLFTRTTTRNHYSVVQELFKGLYENGYMIK
ETTMGAVSPSTGRTLPDRYIEGTCPICGADGARGDQCDNCGNQLDPADLINPVSKINGET
PQFIETEHFLLDLPALADALADWLKERQDWRPNVLKFSLNLLEDLRPRAMSRDIDWGIPI
PVEGWEDNGAKKLYVWFDAVVGYLSASIEWAYRIGKPDAWKEWWTDPAASSYYFMGKDNI
TFHSQIWPAELLGYQGKGARAGKLHTFGELNLPTEVVSSEFLTMSGSKFSSSKGIVIYVK
DFLREFGPDPLRYFIAVAGPENNDTDFTWDEFVRRVNNELANGWGNLVNRTVSMAYKNFG
EVPTPGELTESDQRILKLSAEAFEVVGDALAHSRFKQGITHAMHVVGEANAYIAEQEPWK
LAKDETQRERLATVLWTALQVVSDCNVLLTPYLPHISQQVHETLGRDGVWAAKPQIIEVA
DDMPVEPVGVGVPASGQTYPVIMGDYASQQARWARIDAIPGTSLSKPKPLIAKLDPELGE
TGPEWAPITR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgactaaccgtgtgctcgtttctgttgcttggccttatgccaatggacctcgccacatt
ggacatgtggcagggtttggtgtcccctcggatgttttcgctcgctatcagcgaatggcc
ggtgcagacgtgcttatggtctccggtacggatgagcacggtactccgcttttggttcaa
gcagacaaagaaggagtgtctgtcaaagaactcgctgatcggtataaccgacagatcgtt
gaagatctcgcaggcttgggactgtcctatgatctctttacccgtacaactacaaggaat
cattattcggttgttcaagagctctttaaagggctctatgaaaacggctacatgataaaa
gagaccaccatgggcgctgtttctccctccacagggcgcacgcttcctgatcgctatatt
gagggcacgtgccctatctgtggcgcggacggggcacgcggagatcagtgcgataattgt
ggaaatcaattggatccagcggatttgattaacccggtttcaaagatcaacggcgagacg
ccacagttcattgagactgagcatttcctccttgatcttcctgcactggcagatgctctg
gctgattggctcaaggagcgtcaggactggcgcccgaacgttctcaaattctccttgaat
cttttggaagacctgcgccctcgggctatgagccgtgatattgactggggaatccctatc
ccagttgaagggtgggaagacaacggcgctaagaaactctatgtttggttcgacgcggtc
gtcggttacttatctgcgtcgattgagtgggcatatcgcattggaaagccggatgcgtgg
aaagaatggtggactgatcccgctgcctcaagttattacttcatgggtaaagataacatc
actttccattctcagatctggccggctgagcttttggggtatcaaggaaagggcgctagg
gccggcaaactgcatacttttggggagcttaaccttcctacggaagtggtgtcttctgag
ttccttactatgtccggctctaagttctcttcctctaaaggcattgttatttatgtcaag
gacttccttagggaatttggtccagacccattgcgatatttcattgccgttgcggggcca
gagaataatgacaccgattttacgtgggatgagttcgtccgccgcgtaaacaacgagctg
gccaatggttggggcaaccttgtaaaccgcactgtttccatggcttacaagaatttcggt
gaggtgccaactccaggtgagctgaccgagtcggaccaacggattctcaagctttctgct
gaagcctttgaggttgttggggacgctcttgcacactcacgttttaaacaggggattacg
catgcaatgcatgtggtgggtgaagcgaacgcttatattgcggaacaagaaccatggaag
ctcgctaaagacgagactcagcgtgagcgcctagctacggttttgtggacggcgctgcaa
gtagtctcagactgcaatgtgctgttgactccctatctgccgcatatttcccagcaggta
catgagacgttgggccgtgacggcgtgtgggcggcaaaaccacagatcatagaggttgcc
gatgatatgcctgtggagcctgtcggcgtgggagttcctgctagcgggcaaacatacccc
gtgattatgggcgattatgcgtcgcaacaagcacggtgggcacgtatagacgccatcccg
gggacctctttgtccaagccaaagccgctgattgctaagttggatccggagctgggggag
acaggtccagaatgggcaccgattactcgctag

DBGET integrated database retrieval system