KEGG   Corynebacterium pseudotuberculosis CS_10: CPTB_00350Help
Entry
CPTB_00350        CDS       T03483                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
cpsu  Corynebacterium pseudotuberculosis CS_10
Pathway
cpsu00670  One carbon pool by folate
cpsu00790  Folate biosynthesis
cpsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CPTB_00350
   00670 One carbon pool by folate
    CPTB_00350
Enzymes [BR:cpsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CPTB_00350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AIG08406
UniProt: A0A2L0NTU6
Position
373893..374420
Genome map
AA seq 175 aa AA seqDB search
MLRAIWAQSRDGVIGNGSDMPWHLPEDLAHFKKTTLGCPVIMGRKTWESLPPTFRPLPGR
QNYVLSRSAAGPWSTGACVVSTLPDVTGAWIMGGGQIYDATLPKVKEVVRTIVDVELLDV
LGESAVSAPALGSEFEIVSETEWMASISGKLHREYQDSASSQPLRYKFQSLRRTA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgggcaatttgggcacaatcccgcgacggggtcattggcaatggaagcgatatg
ccctggcatctgcccgaggatctcgcccactttaaaaagaccactctgggctgcccagtg
atcatgggacgcaagacgtgggaatcgctgcccccaacttttcggcctcttcctgggcgc
caaaactatgtgctgtcccgctcagcagccggcccgtggagtaccggtgcttgcgtggtg
agcacgttacccgatgtaacaggcgcgtggatcatgggaggcggacaaatttatgatgcg
acgctaccaaaggttaaggaggtagtgcgcactatcgtggacgttgagcttctcgacgtc
ctcggcgaatccgcggtttccgctcctgcgcttggctccgagtttgagatcgtatcggaa
actgagtggatggcgtcgataagcggaaaactgcaccgagaataccaggactcggcctcc
tcacaaccactgcgctacaaattccaaagtttgcgacgcactgcctaa

DBGET integrated database retrieval system