KEGG   Chlamydia pneumoniae TW-183: CpB0329Help
Entry
CpB0329           CDS       T00136                                 

Definition
(GenBank) tRNA pseudouridine 55 synthase
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
cpt  Chlamydia pneumoniae TW-183
Brite
KEGG Orthology (KO) [BR:cpt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpt03016]
    CpB0329
Enzymes [BR:cpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     CpB0329
Transfer RNA biogenesis [BR:cpt03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CpB0329
 Prokaryotic Type
    CpB0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2
Motif
Other DBs
NCBI-ProteinID: AAP98262
UniProt: Q9Z8L9
Position
360589..361296
Genome map
AA seq 235 aa AA seqDB search
MDLAVELKEGILLVDKPQGRTSFSLIRALTKLIGVKKIGHAGTLDPFATGVMVMLIGRKF
TRLSDILLFEDKEYEAIAHLGTTTDSYDCDGKVVGRSKKIPSLEEVLSAAEYFQGEIQQL
PPMFSAKKVQGKKLYEYARKGLSIERHHSTVQVHLQITKYEYPLLHFVVSCSKGTYIRSI
AHELGTMLGCGAYLEQLRRLRSGRFSIDECIDGNLLDHPDFDISPYLRDAHGNSL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgcagtagaattaaaagagggcattcttcttgtagacaagcctcaagggaga
acttcgtttagccttatccgcgctctaaccaagttaataggcgttaaaaagattggtcat
gcaggaactttagatcccttcgctactggcgttatggtcatgttgattggccgtaaattt
actagactttctgatattttactttttgaagacaaggaatacgaagcaattgcccattta
gggacaactaccgattcttatgattgcgacggcaaagttgtaggaagatctaagaagatt
cctagtctcgaagaagtattatcagctgccgagtatttccaaggagagatccagcaactt
cctcccatgttttccgctaaaaaagtccaagggaaaaagctgtatgaatatgctagaaaa
ggtttatctatagaacgtcaccattctacagttcaagttcacttgcagattacgaaatat
gagtaccctttattgcattttgtagtctcttgtagcaaaggaacttatattcgcagcatt
gctcatgagcttggcacgatgttaggctgtggagcttatcttgagcagctacgccgttta
cgcagtggccgtttttctatagatgaatgtattgatgggaatctattagaccaccccgat
ttcgatatttctccctacctacgagatgcccatggaaatagcctatag

DBGET integrated database retrieval system