KEGG   Chlamydia pneumoniae TW183: CpB0389Help
Entry
CpB0389           CDS       T00136                                 

Definition
(GenBank) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
cpt00020  Citrate cycle (TCA cycle)
cpt00310  Lysine degradation
cpt01100  Metabolic pathways
cpt01110  Biosynthesis of secondary metabolites
cpt01120  Microbial metabolism in diverse environments
cpt01130  Biosynthesis of antibiotics
cpt01200  Carbon metabolism
Module
cpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpB0389
  Amino acid metabolism
   00310 Lysine degradation
    CpB0389
Enzymes [BR:cpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CpB0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AAP98320
Position
complement(419844..420938)
Genome map
AA seq 364 aa AA seqDB search
MTTEVRIPNIAESISEVTVASLLVTEGALIQENQGLLEIESDKVNQLIYAPVSGRIFWEV
SEGDVVPVGGVVGKIEPAGEGEELGDSQSKETIEAEIICFPQSGVRQSPPENKTFIPLRD
QMDQGSQGLSAGDRGETRERMTSIRKTISRRLLSALHESAMLTTFNEVYMTPLFHLRKEK
QEEFLSRYGVKLGFMSFFVKAVLEALKAYPRVNAYIDGEEIVYRHYYDISIAVGIDRGLV
VPVIRDCDKLSNGEIEQKLADLALRAREGLLAIAELEGGGFTITNGGVYGSLLSTPIINP
PQVGILGMHKIEKRPVVLDNEIVIADMMYVALSYDHRLIDGKEAVGFLVKVKEGLENPAS
LLDL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgactacagaagtacgcattcctaatattgcagagtcgattagcgaggtgaccgtagct
tccttgttagttacagagggtgctctgattcaagaaaaccagggcttactagaaattgaa
agtgataaggtaaatcagctcatttatgccccagtatcgggaagaattttctgggaggtt
tcagaaggcgatgttgttcctgtagggggggtagtgggaaaaatagagcccgcaggtgaa
ggggaagagcttggagattctcagtctaaagagactatagaagctgagatcatttgcttt
cctcagtctggggtgcgtcagtctcctccagagaataaaacgtttattcctcttcgtgat
cagatggaccaaggatcccaaggtctttctgcaggagatcgaggagaaactcgagaacgc
atgacctcgattcgtaagacaatttcgcggcgtcttttgtctgctttacatgagtctgcg
atgctcacgacattcaatgaggtctatatgacacctctttttcatttgcgaaaggaaaaa
caagaagagtttctatctcgatatggggtgaagttaggatttatgtctttctttgtgaaa
gctgtcttagaggctttgaaggcatatccacgagtgaacgcctatattgatggcgaggag
attgtttaccgtcactattatgacatttctattgctgtaggtatcgatcgaggacttgtg
gttcctgtgatacgcgattgcgataaactttctaacggggagattgagcagaaactcgca
gatcttgcccttcgggctcgtgaaggcctacttgcaatagcggagcttgagggaggaggt
ttcacaattaccaatggaggcgtatatggatcgctactttcgactcccattatcaatccc
ccgcaagtggggattttggggatgcataagatagaaaagcgccccgttgttcttgataat
gaaattgtaattgcagatatgatgtatgtcgctttaagctatgatcatcgtcttattgat
gggaaagaggctgttgggtttttagtcaaagtgaaagaaggcctagagaatcctgcctca
ttactcgacttgtaa

DBGET integrated database retrieval system