KEGG   Chlamydia pneumoniae TW-183: CpB1071Help
Entry
CpB1071           CDS       T00136                                 

Definition
(GenBank) arginine/ornithine antiporter protein
  KO
K03758  arginine:ornithine antiporter / lysine permease
Organism
cpt  Chlamydia pneumoniae TW-183
Brite
KEGG Orthology (KO) [BR:cpt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpt02000]
    CpB1071
Transporters [BR:cpt02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   CpB1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease YjcB Cg6151-P
Motif
Other DBs
NCBI-ProteinID: AAP99000
UniProt: Q9Z6M8
Position
complement(1179795..1181252)
Genome map
AA seq 485 aa AA seqDB search
MTSRTKSSKNLGTIALAGMVVSSIIGGGIFSLPQNMAATAGAGAVILSWILTGFGMFFIA
NTFRILSTIRPDLKEGIYMYSREGFGPYIGFTIGWGYWLCQIFGNVGYAVITMDALNYFF
PPYFQGGNTLPAILGGSILIWVFNFIVLKGIRQASIINVIGTIFKIIPLIIFIILTAFFF
KLAVFKTDFWGHAVTKAQPSLGSVSSQLKGTMLVTLWAFIGIEGAVVMSGRAKNPLSVGQ
ATVLGFLGCLTIYILFSLLPFGSLFQHQLANIPNPSTAGVLDILVGKWGEVLMNVGLIIA
VLSSWLSWTIIVAEIPFSAAKNGTFPEIFTIENKEKSPSVSLYITSSVMQLAMLLVYFSS
NAWNTMLSITGVMVLPAYLASAAFLFKLSKSKTYPKKGSIKAPLAMITGILGVVYSLWLI
YAGGLKYLFMALVLLALGIPFYIDAGKKKKNAKTFFAKKEIVGMTFIGLLALTAIFLFST
GRIKI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaggactaaatcctcaaaaaatttagggaccatagcccttgcgggtatggta
gtcagttccataattgggggagggattttcagcctcccccaaaacatggcagcgacagca
ggagctggtgccgtaatcctatcttggatactcactggcttcggcatgttctttatcgca
aatacgtttaggatcctctctacaatacgtcccgaccttaaggaagggatctacatgtac
agtagagaaggtttcggcccctacataggattcaccatcggctggggatattggctttgt
caaatcttcggtaatgtgggatatgccgtaattactatggatgctctaaactacttcttc
cctccctacttccaaggaggaaataccctacctgctattttaggaggctccattcttatc
tgggtgttcaacttcatagttctgaaaggaatccgtcaagcatcgataatcaacgtcatc
ggaactatatttaaaatcatccctctaatcatcttcattatcctgactgcgttcttcttc
aagctcgctgttttcaaaacagatttttggggacatgccgtaacaaaagcccaaccgagt
ttaggatccgtaagttcacaacttaaagggactatgttggtcaccctatgggcatttata
ggaatcgaaggtgccgtggtgatgtctggacgagcaaaaaatcctctctctgtagggcaa
gctacagtcttaggatttttaggttgcctaacaatctacatcttattttctttattacct
tttggctcgctcttccaacatcaactagcgaacatccccaatccctctacagctggtgtc
ctcgacatcctcgtagggaaatggggagaagtgctcatgaatgtcggcctgattattgct
gttttatctagctggttatcctggacgatcatcgttgcagaaatccccttctcagcagct
aaaaatggcaccttccctgagatcttcactatagaaaataaagagaaatctcccagcgtc
tccctatacattacgagctctgtgatgcagctcgccatgctccttgtttacttttcttcg
aatgcttggaatactatgctcagcatcacgggggtcatggttctccctgcgtatctagcg
agtgctgcctttctctttaaacttagcaaaagcaaaacatatcctaaaaaagggtctatt
aaagcccctttggcaatgataactggtatcctgggagtggtttactctctatggcttatc
tatgcaggaggtctaaaatacctctttatggccttagttcttttagctcttggcatcccc
ttctatatagacgcagggaaaaagaagaaaaatgctaagacattctttgctaaaaaagaa
attgtaggaatgactttcataggccttcttgcgctgacagcgatcttcctattctcaaca
ggaagaatcaaaatttaa

DBGET integrated database retrieval system