KEGG   Coniophora puteana: CONPUDRAFT_107905Help
Entry
CONPUDRAFT_107905 CDS       T03134                                 

Definition
(RefSeq) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cput  Coniophora puteana
Pathway
cput00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cput00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CONPUDRAFT_107905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cput01007]
    CONPUDRAFT_107905
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cput03016]
    CONPUDRAFT_107905
   03029 Mitochondrial biogenesis [BR:cput03029]
    CONPUDRAFT_107905
Enzymes [BR:cput01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     CONPUDRAFT_107905
Amino acid related enzymes [BR:cput01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CONPUDRAFT_107905
Transfer RNA biogenesis [BR:cput03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CONPUDRAFT_107905
 Prokaryotic type
   Other AARSs
    CONPUDRAFT_107905
Mitochondrial biogenesis [BR:cput03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CONPUDRAFT_107905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1
Motif
Other DBs
NCBI-GeneID: 19198672
NCBI-ProteinID: XP_007771242
JGI: Conpu1_107905
Position
Unknown
AA seq 607 aa AA seqDB search
MSTSQNPFWYKLTSVPDTDPSSCVLDAFRIAIAERVASALPPLTVEKAYSGVDYGKKGVD
FTVALPRFRLPGKVDELAKKVIDAFQPDDFVASVVHDKAFLHFQLNTTSLIREVVNQIYT
TTYEPGQGLDANAEPTNPRYGTNSSGGGKTLVIEYSSPNIAKSFHVGHLRSTIIGAFLAN
LYKACGWKVLSVNYLGDWGTQFGMIATGFEKYGSQEALERDPIKHLYDVYVQISREAEAD
PNVKVEAAKWFKRMEDGDESALANWRVWRELSIKKYTEEYERLNVQFDVYTGESEVGKEW
QDKALQRLEEMNLVSDANGAKLVDLEKWKLGKAVLRKADGTSIYLTRDIGGAIERYEKWN
FDKMIYVISSQQDLHVAQFFKMLKLMEFPWADRLEHVNYGLVQGMSTRKGTAVFLADIIR
EASTVMHEQMKRNEEKYNAIQDPETTSREVGISGVKIQDMAAKRINNYNFNWDRMLSFEG
DTGPYLQYAHVRLCSMERRNPEVFPLPAPSSIDFNVLADSQHARDIAILLGSYPDVVKTA
LKTHEPSGVVTFAFRLAHAISSAWETLVVKGEQDRGKAQARFWLYRSARDTLGAAMRLLS
IRPMEHM
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacatcccagaaccctttctggtataagctcacgtccgtcccggatacggacccg
agctcgtgtgtcctcgacgcgttccggattgccatcgccgagcgcgtcgcgagcgcgctg
ccccctctgacggtcgaaaaagcatactcgggcgtcgattacggcaagaagggtgtcgac
ttcacggttgcgttgccgcgcttccggttgcccggtaaggtggacgagctggcaaagaag
gtcatcgatgctttccagcccgacgacttcgtcgcatccgtcgtacacgacaaggccttc
ctccacttccagctcaacactacttccctcatccgcgaagtcgtcaaccagatctacact
accacctacgagcccggccagggactcgatgccaacgccgagccgaccaacccgcgctac
ggtaccaacagctcgggcgggggcaagacgctcgttattgagtactcatcacccaacatc
gccaagtcgttccatgttggtcacttgcgcagcacgatcatcggcgcgttccttgcaaac
ctgtacaaggcatgcgggtggaaggtgctttcagtgaactatctgggcgattggggcacc
cagttcggcatgattgccactggcttcgagaaatacggctcgcaagaggcgctcgaaaga
gatcccataaaacatctgtacgacgtctacgtgcagatcagccgcgaggccgaggcggac
ccgaacgtcaaggttgaggctgccaaatggttcaagcgcatggaagatggggacgagagc
gcgctcgccaactggcgcgtctggcgcgagctcagcatcaagaagtacactgaggagtat
gaacgactaaacgtacaattcgatgtgtacacgggagagagcgaagtcggcaaggagtgg
caggataaggcgttgcagcggcttgaggagatgaacttggtcagcgatgcgaatggggcg
aagctggtggatctggagaagtggaagttgggcaaggctgtgttgcggaaagctgacggc
acgtccatatacctcacgcgcgacattggcggtgcgatcgagcgatacgagaaatggaac
tttgacaagatgatctacgtcatctcgtcacagcaagacctacacgtcgcacagttcttc
aagatgctcaagctgatggagttcccgtgggccgacagactcgagcacgtcaactacggg
ctcgtgcagggcatgagcacgcgcaagggcaccgccgtgttcctcgccgacatcatccgt
gaggcgtcgacggtgatgcacgagcagatgaaacgcaacgaagagaagtacaacgccatc
caggaccccgagaccacgagtcgcgaggtggggatttcgggggtaaagattcaggatatg
gctgccaagcggataaacaactacaacttcaactgggaccgcatgctctccttcgagggt
gacacgggcccctacctccaatacgcacacgtccgcctctgctcgatggagcgccgcaac
cccgaggtcttccccctccccgcgccctcgtccatcgacttcaacgtgctcgcggacagc
cagcacgcgcgcgacatcgcgatcctgctcggctcgtacccggacgtggtgaagacggcg
ctcaagacgcacgagccctcgggcgtcgtcacgttcgcgttccggctcgcgcacgcgatc
tcgagcgcgtgggagacgctggtggtcaagggcgagcaggatcgcgggaaggcgcaggcg
cggttttggctgtataggagtgcgcgggatacgttgggcgctgcgatgcggttgttgagt
attcggccgatggagcatatgtga

DBGET integrated database retrieval system