KEGG   Coniophora puteana: CONPUDRAFT_114920Help
Entry
CONPUDRAFT_114920 CDS       T03134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cput  Coniophora puteana
Pathway
cput00260  Glycine, serine and threonine metabolism
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
cput01130  Biosynthesis of antibiotics
cput01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CONPUDRAFT_114920
Enzymes [BR:cput01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CONPUDRAFT_114920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 19199112
NCBI-ProteinID: XP_007763309
JGI: Conpu1_114920
Position
Unknown
AA seq 418 aa AA seqDB search
MDNKLEDIAAQIKFDILTPTQDVDNEKLIEEVSRSFISDTITVPTKEMYAYAVRTSVGDD
VYHEPSMLALEAHMAKIAGKEAAMFIPSGTMSNQLALRTHLQQPPYSVICDVRGHINKYE
AGGTSFHSGAHLICVNPSNGHHLTLEDIQDYVVEGSDIHTSPTRVISLENTLNGTIMPQH
EAVAICNYAHQLDIRTHLDGARLWHVAAETRTPMHELCAPFDSVSLCFSKGLGAPVGSCL
VGSKQFIAKARWFRKLFGGGMRQTGILAGAAAYALTYNFPQLPYVHTLTKELEDGLVELG
AKIISPAETCMLFYDPAPIGVTYQEIAHRASELARPIAVGGSRLVVHIQTSPEAIADLLG
VIRTLKEEKAREGVNRLVDTMNGVRLNGTNGCPNCGKGAKQLASSSFNIYAKPPKKSA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaagctcgaggacatcgccgcccagattaaattcgacatcctcaccccaact
caggatgttgacaatgagaaactcatagaggaggtctcaaggagcttcatctcggacacc
atcacagttcctactaaggagatgtacgcctatgccgttcgtacctctgttggcgacgac
gtctatcatgaaccctctatgctcgcccttgaggcccacatggccaagattgccggcaag
gaggccgccatgtttataccaagtgggacgatgagcaaccagcttgcactgcggacacat
ttgcaacagcccccgtactccgtcatttgcgacgtgcgaggccatatcaacaaatatgag
gcgggcggaacgtcgttccattcaggggcccacctgatctgcgtcaacccatccaatggg
catcacttgacgcttgaggacattcaagattatgtcgttgaaggttctgatatacacact
tctcctacgagagtcatttcattggaaaacaccctcaatggcaccatcatgcctcagcat
gaggcagtggctatctgcaattacgctcatcagcttgatatccggacacatcttgatggc
gctcggttgtggcacgtagcagcggagacccgcaccccaatgcacgagctctgcgcgccg
tttgattccgtcagtttatgttttagcaagggactcggtgcacccgttgggagctgtctc
gtcggatcgaagcaattcattgccaaggcccggtggttccgcaagctttttggtggagga
atgcgtcagactggtatcctcgccggcgcagcagcctacgcgctcacttacaacttccca
caactaccatatgtccacactttgaccaaggagctggaggatggactcgtggagcttgga
gcgaagatcattagtcccgctgaaacttgcatgctcttctacgatccggcaccgatcgga
gtcacctaccaggagatcgctcatcgagcatccgaacttgcccggccaatcgctgttgga
gggtcgcggcttgttgtgcacatccaaacttctcccgaagctatcgctgatctactcggg
gtcatccgcaccttgaaggaggagaaagctcgcgagggggtcaacaggctggtagacacc
atgaatggtgttcgcctcaacggtaccaatggatgccccaactgtggaaagggagccaag
cagctggcttcgtcgtcgttcaacatttatgcaaagcctccaaagaagtcggcttga

DBGET integrated database retrieval system