KEGG   Coniophora puteana: CONPUDRAFT_136949Help
Entry
CONPUDRAFT_136949 CDS       T03134                                 

Definition
(RefSeq) Nop domain-containing protein
  KO
K14565  nucleolar protein 58
Organism
cput  Coniophora puteana
Pathway
cput03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cput00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CONPUDRAFT_136949
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cput03009]
    CONPUDRAFT_136949
Ribosome biogenesis [BR:cput03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    CONPUDRAFT_136949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 19200965
NCBI-ProteinID: XP_007768111
JGI: Conpu1_136949
Position
Unknown
AA seq 572 aa AA seqDB search
MLVLFETAMGYCLFKLTDAAKLESEDLWKEFETPEKANKLLKLKALHRFTSTATAVEDLT
AVQSGKLGKGLKKFLTTEVVEKGKNKDSLVVLDPHLAHSITKKLSIKVTTHNPEEHSDLW
RGIRSQLASLLDGLDPKDLATMSLGLSHSLSRFKLKFSPDKVDTMIVQAIALLDDLDKEI
NIYSMRVKEWYGWHFPEMAKIIVDNLAYAKVVKAMGFRTNASTTAFETILPEDLEAILKA
AAEISMGTEISDSDIQHIHALCDQVISISAYRAQLAEYLRNRMQAIAPNLTALVGDLVGA
RLISHAGSLLNLAKHPASTVQILGAEKALFRALKTKHDTPKYGLIYHASLIGQAPPKLKG
KMARMVATKATLSIRVDALTDADGKSEDQAPSIGMDNRAKLESRLRALEMQGDLTGARKF
SDNSRQQRKFEMTGQTKTYNTDADAVDLVPSQREPMEAAISAVLDVKEEKRRAKEEKKAK
KKAEKAKAHESDDDDDDEDRMDVDGDESHKEKKRKRRESDMNGKGDTEEKGEDGETEAER
KARRKARKAEKAAAAVAGDNSPKKKKKKAESS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgttggttctctttgagaccgcgatgggctactgcctcttcaagctcaccgatgctgca
aaacttgaatcggaggacttgtggaaggagttcgagaccccagaaaaagccaacaagctc
ttgaaattgaaagctttgcatcgcttcacctcgacagctactgcggtggaggatctaacg
gcagttcagagtggcaaacttggcaagggcctcaagaagttcttgactactgaagttgtt
gaaaaggggaagaacaaggactctcttgttgttcttgatcctcatctagcgcattccatc
accaaaaaattgagtatcaaggtcactactcacaacccggaggagcatagtgatctatgg
cggggaatacggtcgcaattggcttctcttctagatggtctcgatccaaaggaccttgcc
acgatgagcttaggtctcagtcattcactttcccgtttcaagctgaaattttcccctgac
aaggtcgacaccatgattgttcaggccatcgccctactcgacgatctagacaaagagatt
aacatctactccatgcgagtgaaggaatggtacggctggcatttccctgaaatggccaaa
atcattgtcgacaacttggcttatgccaaggttgtcaaggctatgggtttccggaccaat
gcttccaccaccgctttcgagacgatattaccggaagaccttgaggctatcctgaaggcg
gctgctgagatatcaatgggcactgaaatttctgactcagatattcagcacattcatgcg
ctttgcgaccaggtcatctctatctccgcctaccgtgcgcagcttgcagagtacctccgg
aatcggatgcaagcaattgctcccaaccttactgcgcttgttggagatctcgttggcgca
cggctcatctcccacgctggaagcttactgaaccttgcaaaacaccccgcaagtaccgtt
cagatcctcggcgctgaaaaagcgctcttccgtgccctcaaaaccaaacacgacacgccg
aaatacggtcttatttatcatgcatcactcattggccaggcaccaccaaagttgaagggc
aagatggcgcgtatggtcgcaactaaggctaccctctcaatacgcgttgacgcgctgacg
gacgcggatggcaagtctgaggaccaggctccgtcaatagggatggacaaccgtgcaaag
cttgagtcgaggctccgcgcgcttgaaatgcaaggcgaccttactggtgcacggaaattc
tccgataacagccggcagcagcgcaagtttgagatgaccgggcaaacgaagacatacaac
accgatgctgacgccgtcgacctcgtcccgtcacaacgagagcctatggaggctgccatc
agcgcagtacttgatgtcaaggaggagaagaggagagcaaaggaggaaaagaaggcgaag
aagaaggctgagaaagcgaaggcacatgagtctgatgatgacgatgacgatgaggacaga
atggacgttgatggcgatgaaagtcacaaggagaagaagcggaagcggagggaaagtgac
atgaatgggaagggtgataccgaggagaagggcgaagatggcgagactgaagctgagcgc
aaggcaagaagaaaggcccgaaaagcagagaaggctgctgccgctgtcgccggggacaac
tcgccaaagaaaaagaagaaaaaggccgagtcttcttga

DBGET integrated database retrieval system