KEGG   Coniophora puteana: CONPUDRAFT_138956Help
Entry
CONPUDRAFT_138956 CDS       T03134                                 

Definition
(RefSeq) Pkinase-domain-containing protein
  KO
K04563  cyclin-dependent kinase [EC:2.7.11.22]
Organism
cput  Coniophora puteana
Pathway
cput04011  MAPK signaling pathway - yeast
cput04111  Cell cycle - yeast
cput04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cput00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    CONPUDRAFT_138956
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CONPUDRAFT_138956
   04113 Meiosis - yeast
    CONPUDRAFT_138956
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cput03019]
    CONPUDRAFT_138956
Enzymes [BR:cput01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     CONPUDRAFT_138956
Messenger RNA biogenesis [BR:cput03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     CONPUDRAFT_138956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kdo Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 19201276
NCBI-ProteinID: XP_007772097
JGI: Conpu1_138956
Position
Unknown
AA seq 294 aa AA seqDB search
MDRYAKIEKVGAGTYGVVYKARDVTNNHIVALKKIRLEAEDEGVPSTAIREISLLKELKD
DNIVRLLDIVHADQKLYLVCEFLDVDLKRYMERANSTGSPMTVDITRKFTHQLNAGLYYC
HSHRILHRDLKPQNLLIDRRDNLKLADFGLARAFGIPMRTYTHEVVTLWYRAPEVLLGSR
HYSTAIDMWSVGCIFAEMIMRGNPLFPGDSEIDQIFKIFRILGTPSEKVWPGVSQLPDYK
ETFPQWSTQDLRNILPQLDEDGIDLLIQTLMYDTAKRISAKRALIHPWFANYEP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatcgctatgccaagatagagaaagtcggtgcaggcacgtacggtgtcgtgtacaag
gcgcgcgacgtgacgaacaaccatatcgtcgcgctcaagaagatccggctcgaggctgag
gacgagggcgtgcccagcactgctattcgcgagatcagtctgctcaaggagctcaaggac
gacaatatcgtccggctgctcgacatcgtgcacgcggaccagaagctctacctcgtgtgc
gagttcctcgacgtcgacctcaagcgctacatggagcgggccaacagcaccgggtcgccc
atgaccgtcgacattacccggaaattcacgcaccagctgaacgcgggcctgtactattgc
cactcgcaccggatcctgcaccgcgatctgaagccgcagaatctgttgattgaccggagg
gataatctgaagcttgcggattttgggctggcgagggcgtttgggattccgatgcggacg
tatacgcatgaggtcgtcacgctgtggtaccgcgcgccggaggtgctcctcggctcgcgg
cactactcgaccgcgatcgacatgtggtcggtcgggtgtatctttgcggagatgattatg
cgcgggaacccgctgttcccgggtgattcggagattgaccagattttcaagattttcagg
atcttgggtacgccgagcgaaaaggtgtggccgggcgtgagccagttgccggactataag
gagacgtttccgcagtggtcgacgcaggatctgaggaacattttgccgcagttggatgag
gatgggattgatttgcttattcaaacgctgatgtatgatactgcgaagcgtatctcggcc
aagcgggcgctcattcatccgtggttcgcaaactacgagccctga

DBGET integrated database retrieval system