KEGG   Coniophora puteana: CONPUDRAFT_139768Help
Entry
CONPUDRAFT_139768 CDS       T03134                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
cput  Coniophora puteana
Pathway
cput04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:cput00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    CONPUDRAFT_139768
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cput04131]
    CONPUDRAFT_139768
Membrane trafficking [BR:cput04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    CONPUDRAFT_139768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin ANAPC4_WD40 zf-RING_2 WD40_like zf-RING_5 Zn_ribbon_17 Vps39_2 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 19201397
NCBI-ProteinID: XP_007773652
JGI: Conpu1_139768
Position
Unknown
AA seq 999 aa AA seqDB search
MTEEDGDEEEEEAEEDDDDDDEEEDEEDEEPALKYERLSAPVDTLLRKDSASAVAVSSDR
IALGTHAGYVHILKLNGERVKSYKPHTASILDMSLDATGDFFTTASIDGQIAIHSLSTPE
NYVFDMKRPMRTVALEPGFARKKSRAFVCGGMAGTLILREKSWFGHSETTLHSGEGPIYQ
VRWRDRLIVWANDLGVKLYDTASQSRIAFIDRPPDSPRADLFKCTLYWQDDSTLILGWAD
HIKVLRIRTRTRNSTGVAGSAGLTSSPPLVVEVTAVFQLDCMIAGIVPHTLSPASVSPPH
SHSHSKESSLSTNGTVENGKDSSSNSLSGSGTGAKSLPLTSFLVLAYSPPDTYGDEATQD
RARQARKAAERPELRIISRAGEELTADALGVANFQAWSCNDYVLAEVGALDPGLSVVPPA
AGAAGALRVQARRSYVVVSPKDIVVVRPRDRRDHIAWLVEHQRYDEALGEVEKLGDEELG
EGEARIDANAIGERYIKHLVGEGDFVKAAKLCPKVCGHDVKQWEDWIFLFAQKQELQAII
PYIPVDSPQLGHMVYEMVIGHYLTHDKHALFETIKSWPKTIYDIPAVINAIQSALDRSPS
TSSATSISSSSRSTTPDAVLLMECLAELYTANRQYGKALPFYLRLRRPNVFELIREHNLF
TDVQDQALLLVEFDQELIEKRRREGVEVDEGGSEAIRLLVDHTYSIPIRRVVQQIESRPH
FLFLYLDALSKKDPHLTSSFADLQVKLCADYAPSRLIDFLRQSNYYNLEAAYKACGERDL
VPEMVFLLGRMGNNKQALTLIIERLGDVERAIEFAKEQADDDLWEDLLKYSETRPAFIRG
LLENVGVEIDPVRLVRRIKNGLEIPGLKDALIKILHDFHLQISLLEGCQTILEGDGAYLT
RVRQRSQMSGFFLGDKSECMICSKPLLRAPQDLLLLFLCRHVVHAACVPDLSLDDLPWAN
DGVGIRASLSGRIAFTSVIRARIHQGCPVCLRQSEGEVL
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggaggatggcgacgaagaggaagaagaggcagaggaagacgatgacgatgac
gatgaagaggaggacgaggaggatgaagagcctgcgctcaagtatgaacggttgagcgca
cccgtcgacacactcctcaggaaggactctgcctctgccgtcgccgtctcgtcagatcga
atagcactcggcacgcacgccggctacgtgcacatcctcaagctcaatggtgaacgcgtc
aaatcgtacaaaccacacaccgcttccatcttggacatgtccctcgacgccaccggagac
ttcttcactaccgcgtccatcgacggtcaaatcgccatccactccctctccacgcccgag
aactacgtgttcgacatgaagcggccgatgcggactgtcgcgctcgagcctggcttcgcg
cgcaagaagtcgcgcgcgttcgtctgtggtgggatggcggggacgctcattctccgcgag
aagagctggttcgggcatagcgagacgacgctgcattcgggcgaggggccgatatatcag
gtgcggtggagggacaggcttatcgtgtgggcaaatgatcttggtgtcaagctgtacgac
accgcgtcccagtcgcgcatcgcgttcatcgaccggccgcctgatagtccccgagcggat
ctgttcaagtgcacgttgtattggcaggacgactcaacgctcatcctcggctgggcggac
cacatcaaggttctgcgtattcgcacgcgcacacggaactctaccggcgttgccggttct
gcgggactcacaagttcgcctcccctggtcgtagaagtgacggccgtcttccagctcgac
tgcatgatcgccggcatcgtcccacacactctgtctcccgcctccgtttccccgccacac
tcccattctcactcgaaagaaagctcgctatccacaaatggcactgtagaaaatggcaaa
gactcaagctcaaactcgctatcaggctcaggcaccggtgctaaatccctcccgcttacc
tccttcctcgtcctcgcatacagcccaccggacacgtacggcgacgaagcgacacaggac
cgcgccagacaggcacgtaaagccgccgagcgccccgagctgcgcattatatctcgcgca
ggagaggagctcacggccgacgcactcggcgtggcgaatttccaggcatggagctgcaac
gactacgtccttgccgaggtcggcgcgctcgatcccggtcttagcgttgtaccgccggct
gcgggtgccgcgggcgcgttgcgggtgcaggcgaggaggagctatgtggttgtgagtccg
aaggatattgtggttgtgcggccgagagaccggcgggaccatattgcgtggttggtggag
catcagcggtatgatgaggcgttgggggaggtggagaagctcggtgatgaggagctgggc
gagggcgaggcgaggatcgatgcgaatgcgattggggagaggtatattaagcatttggtc
ggtgaaggtgacttcgtcaaggcggcgaagctgtgtccaaaggtctgcggtcacgatgtg
aagcagtgggaagactggatattcctatttgctcagaaacaggaacttcaggctatcatc
ccgtatatcccagtcgactcgccccagctaggccacatggtgtacgagatggtcattggc
cactacctcacgcacgataaacacgccctcttcgaaacaatcaagtcatggcctaaaacc
atctacgacatcccagcagtcatcaacgccatccaatccgcactcgaccgctcgccctct
acctcctctgctacctccattagctcttcctcgagaagcacgacgcccgacgccgttctc
ctcatggagtgcctcgcggagctgtacactgccaaccggcagtacggcaaagcgctgccc
ttctacctccgcctgaggagaccgaacgtgttcgagctcatccgggagcataatctgttc
acggatgtacaggaccaggcgctgttgctcgtggagttcgatcaggagctcattgagaaa
aggaggagggagggtgtggaggtggacgagggtgggagcgaggctattcggttgttggtg
gaccatacgtattccattccgattaggagagtcgtacagcagatcgagagccggcctcat
tttctgttcctttacttggatgcgttatcgaagaaagacccgcaccttacatcaagcttt
gctgatttgcaggtcaagctgtgcgccgattacgcgccatcgaggctcatcgacttcctt
cggcaaagtaactactacaacctcgaagctgcgtacaaagcatgcggggaacgtgacctc
gtacccgagatggtcttcctccttggtcggatgggcaacaacaagcaggcgctgacgctt
atcatcgagcggctaggcgacgttgagcgggcgatcgaattcgcaaaggagcaagcagac
gacgatctctgggaagatctcctcaagtactcggagacccgcccagccttcatccgcggc
ctgctcgagaacgtcggcgtcgagatcgaccccgtgcggctcgtgagaaggatcaagaac
gggctcgagatcccaggcctcaaagacgcactcatcaagattctgcacgatttccatctg
cagatatcgctgctcgaggggtgccagacgatcctcgagggcgatggcgcctatctgacg
agggtgcggcagcggagccagatgagcgggttcttcttgggcgataagtcagaatgtatg
atctgcagcaagcctctccttcgcgcaccgcaggacctgctcctgctctttttgtgccga
cacgttgtccacgctgcatgcgtgcccgaccttagcttggatgaccttccatgggcaaat
gatggcgtcggcattcgtgccagccttagcggacgcatcgccttcacgtcagtcatacgc
gcgcggatacaccagggctgccctgtctgcctccggcagagtgagggcgaagttctgtag

DBGET integrated database retrieval system