KEGG   Coniophora puteana: CONPUDRAFT_140383Help
Entry
CONPUDRAFT_140383 CDS       T03134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cput  Coniophora puteana
Pathway
cput00450  Selenocompound metabolism
cput00970  Aminoacyl-tRNA biosynthesis
cput01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CONPUDRAFT_140383
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CONPUDRAFT_140383
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cput01007]
    CONPUDRAFT_140383
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cput03016]
    CONPUDRAFT_140383
Enzymes [BR:cput01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CONPUDRAFT_140383
Amino acid related enzymes [BR:cput01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CONPUDRAFT_140383
Transfer RNA biogenesis [BR:cput03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CONPUDRAFT_140383
 Prokaryotic type
   Other AARSs
    CONPUDRAFT_140383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-GeneID: 19201506
NCBI-ProteinID: XP_007775162
JGI: Conpu1_140383
UniProt: R7SFN4
Position
Unknown
AA seq 548 aa AA seqDB search
MELQSQGVVSKEFSGAQTKPYYVTTPIFYPNAVPHIGHLYTLVTGDILARHARIAHPDRV
VKFLTGTDEHGLKIQKVAAERGVRPMALCDRLSGQFRRLAGSANVSGTVFMRTTSAEHRR
AVEHVWKQLDAKGLIYKDAYEGWYSVSDECFYTHSQVHKTTLPSGEEITVSTETGSTVEW
SQEENYKFRLSAFRETLLEHYTRDKGSIFPSSYHEYLVDLLKNNDLDDLSVSRPRTRLEW
GVPVPGDPEHTIYVWFDALTVYLSGIGFPWAGGAAEGSGAGWAPDVQVIGKDILRFHAIY
LPAMLKALELPLSRTILTHAHWTVNQRKMSKSVGNVVDPFEAMEIYGVDVVRFYLARVGG
RFRDDVDWSTEQLDKHSDELRNLLGNLFMRITSKAIRARVAKADEKLDVKALLSDTEKAK
ALGVDLELLNSVGALGATVRKNFDMLELGDALEAIMLVLRQANATMTNSAPWAQDPQPAA
ASYVSVLETIRVCALCLQPFIPEAAQRLLDAMDVRESERTLGYAEVGVGAVGEKVEGVKL
FNIPQVKV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggagttgcaaagtcaaggagttgtgtcaaaagaattcagcggtgcgcagactaagccg
tactacgtcaccacacccattttctatccgaacgccgtgccgcacatcggacacctctac
acgctcgtgacgggcgacattcttgcgcggcacgcgcgcatcgcgcacccggacagggtt
gtgaagttcctcacgggcacggacgagcacgggctgaagatccagaaggtcgctgcggag
cggggtgtgcggccgatggcgctgtgcgatcggctgagcgggcagttccgtaggctggcg
gggagcgcgaatgtgagcgggacggtgttcatgcgcacgacgagtgcggagcatcggagg
gccgttgagcatgtttggaaacaactcgacgcgaaagggctcatctacaaagacgcgtac
gagggatggtactctgtctcggacgaatgcttctacacccactcccaagtccacaagacg
accctcccctcgggcgaagaaatcacggtgtcgacggagaccgggtcgaccgtcgagtgg
tcccaggaggaaaactacaagttccgtctatccgcgttccgcgagacgctgctcgagcac
tacacgcgcgacaagggctcgatcttcccgtcgagttatcacgagtacctcgtcgacctg
cttaagaacaacgacctggacgacctctcggtgtccaggccgcgcacgcggctcgagtgg
ggtgtgccggtgccaggggacccggagcacacgatctacgtgtggttcgacgcgctgacg
gtgtacctcagcgggatcgggtttccgtgggcgggcggggcggcggagggcagcggggcg
gggtgggcgccggatgtgcaggtgattgggaaggatatcctccggtttcatgcgatctat
ctgccggcgatgctcaaagcgctggagttgccgctctcgcgcacgattctgacgcatgcg
cactggacggtcaatcagcgcaagatgtccaagtcggtgggcaacgttgttgatccgttt
gaggcgatggagatatacggggtagatgttgtgaggttctacctcgcgcgtgtgggggga
cggttcagggatgatgtcgactggtcaacggagcagctcgacaagcactcggacgagctt
cgtaatctacttgggaacctctttatgcggatcacgtccaaggcgattcgtgcacgcgtg
gcgaaagccgatgagaagctggacgttaaagcgcttctatcagacacggagaaggcgaaa
gcgctcggcgtcgacttggagctgctgaacagcgttggtgcgctgggagccactgtacgg
aagaattttgacatgctcgagctcggagatgcgctggaggcgatcatgcttgtgcttcgc
caggccaatgcgactatgaccaacagcgcaccttgggcgcaggatccccagcccgcggct
gcgtcgtacgtttcggtccttgagacaatccgagtctgtgcgctgtgcctgcagccgttc
atacctgaggcggcccagcggcttctggacgcgatggacgttcgagagagcgagcgtaca
ttggggtacgccgaggtgggcgtgggggcagtgggcgagaaggtggagggtgtgaagctg
tttaatattccgcaggtcaaggtgtag

DBGET integrated database retrieval system