KEGG   Coniophora puteana: CONPUDRAFT_144722Help
Entry
CONPUDRAFT_144722 CDS       T03134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cput  Coniophora puteana
Pathway
cput00350  Tyrosine metabolism
cput00360  Phenylalanine metabolism
cput00380  Tryptophan metabolism
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CONPUDRAFT_144722
   00360 Phenylalanine metabolism
    CONPUDRAFT_144722
   00380 Tryptophan metabolism
    CONPUDRAFT_144722
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    CONPUDRAFT_144722
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cput04147]
    CONPUDRAFT_144722
Enzymes [BR:cput01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     CONPUDRAFT_144722
    4.1.1.105  L-tryptophan decarboxylase
     CONPUDRAFT_144722
Exosome [BR:cput04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CONPUDRAFT_144722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC NESP55
Motif
Other DBs
NCBI-GeneID: 19201979
NCBI-ProteinID: XP_007769655
JGI: Conpu1_144722
Position
Unknown
AA seq 581 aa AA seqDB search
MDIEQFRKAGYQAIDRICEYYYSLQDKPVQSQVEPGYLRKALPDAPPDVGEDFQEIADDY
QKLIIPGLTHWQHPSFFAYFPTGCTYEGILGELYATSTANPGFNWSASPACTELEAVVMD
WAAKLLGLDAAFYNASEVGGGVIQTSASDSALTTVVVARSRYQRASPEVSTQQLVIYCTT
QTHSLGKKAGLVLGIPVRALEVTSEDRYGLRGETLRRALEEDTARGLRPFILIATVGTTS
SGGVDYLEELGPVVAEYPSLWVHVDAAWAGVALACPEFRETCQLEAINKYGDSVCVNFHK
WGLTNFDNSCLWVRDRTDLINALDITPEFLRTKHGDAGTVIDYRNWHLGFGRRFRSLKFW
FVLRSHGVQGFQDYIRRTIRMNDKFIALLRSSLLFKLVTAPFLALTVFRLVPPASSLPLS
VSSPPQPDADSDADAETEIETETETDSATAPLSEPQLNALNRAFYARVCARPDIMLTQTD
LLGTFCIRLAVGAARTSEKHMQAAFDLLTEEAQATLKEWDWTGAGVNGVKEVNGINDVKE
VNGINGVEAVNGVKVMIMNGVNGVNGVHADEVDEPDEARDL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggatattgaacagtttcgcaaggcaggctaccaggccatcgacagaatatgcgagtac
tactactccctccaagacaagcccgtccagtcccaggtcgaacctggctacctcagaaag
gcgctccccgacgcgccgccggatgtcggcgaagacttccaggagatcgcagatgactac
cagaagctcatcatacctggtctcacgcactggcaacacccgtctttcttcgcgtacttc
ccgaccggctgcacgtatgagggcatattaggcgagctgtatgcgacgagcaccgcgaac
ccggggttcaactggtccgcaagtcctgcgtgcaccgagctggaggcggtggtaatggat
tgggcagcgaagttgctgggtctggatgcagcattctacaacgcgtcggaggtgggtggg
ggcgtcatccagacctcggcatccgacagcgccctcaccacagtcgtcgtcgcgcgctcg
cgataccaacgcgcctcccccgaagtttccacccagcagctcgtcatctactgcacgacg
cagacacactccctcggcaagaaagccggtctcgtgctcgggatacccgtgcgcgcgctg
gaggtgacgtccgaggaccggtatgggctgcgtggggagacgctgcgcagggcgctggag
gaggacacggcgagggggctgaggccgttcattctcatcgcgacggtgggcacgacctcg
tcaggaggcgttgattatctcgaggagctcgggccagtagttgctgaatacccctcactg
tgggtgcacgtcgatgctgcttgggcaggtgtcgcgctcgcatgcccagagttccgcgag
acgtgccagctggaagcgatcaacaagtacggcgactccgtctgtgtgaacttccacaaa
tggggcctgaccaacttcgataactcatgtttatgggtgcgcgatcgcacagacctcatc
aacgcgctcgacatcacccccgagttcctccgcacgaagcacggtgacgcaggcacggtc
atcgactaccgcaactggcaccttggcttcgggcgacgcttccgctcgctcaagttctgg
ttcgttttgcgctcgcacggtgtgcaggggttccaggactacatccgacgtaccatccgg
atgaacgacaaattcatcgcactcctccgctcctcgctcctcttcaaactcgtcacagcc
cccttcctcgcgctcaccgtcttccgcctcgtccctcccgcttcctccctgcccctttcc
gtctcctctccgccacaaccagacgcagactcagacgcagacgccgagacagaaatagaa
acagaaacagagacagactcagccaccgcaccactcagcgaaccccagctcaacgcgctc
aaccgcgccttctacgcgcgcgtgtgcgcccggccggacatcatgctcacgcagacggac
ctgctcggcacgttctgcatccgtctggccgtcggcgccgcgcgcacgtctgagaagcat
atgcaggctgcgtttgacctgctcactgaggaggcgcaggcgacgctcaaggagtgggat
tggacgggtgcgggggtgaacggggtgaaagaggtgaatgggattaacgatgtgaaagag
gtgaatgggatcaacggtgtggaagccgtcaacggagtcaaggttatgattatgaacggg
gtcaacggggtgaatggggtgcacgcagatgaagtggatgagccggatgaggcgcgcgat
ctgtag

DBGET integrated database retrieval system