KEGG   Coniophora puteana: CONPUDRAFT_144842Help
Entry
CONPUDRAFT_144842 CDS       T03134                                 

Definition
(RefSeq) amidase signature enzyme
  KO
K01426  amidase [EC:3.5.1.4]
Organism
cput  Coniophora puteana
Pathway
cput00330  Arginine and proline metabolism
cput00360  Phenylalanine metabolism
cput00380  Tryptophan metabolism
cput01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CONPUDRAFT_144842
   00360 Phenylalanine metabolism
    CONPUDRAFT_144842
   00380 Tryptophan metabolism
    CONPUDRAFT_144842
Enzymes [BR:cput01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     CONPUDRAFT_144842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 19201992
NCBI-ProteinID: XP_007769999
JGI: Conpu1_144842
Position
Unknown
AA seq 530 aa AA seqDB search
MTGSENAATFPDLYEASISELQNGLGQGLFTSVDLVKAYLARIEEVNLKGATLRAVIETN
PPVLEQAKALDEERRVKGPRGPLHGIPMLLKDNIATLHEEGMNTTAGSHALVGSVVPRDA
HAAHLLRAAGALFLGKSNLSEWANFRGIVPSGFSGRGGQAHCPYDPSGKGDPSGSSSGSA
TAVAVGLCAGALGTETDGSIVSPSSRNNVVGVKPTVGLVSRAGVIPISSNQDTAGPMCRT
VMDASLILSAIAGRDTRDAATLEQPENIPDYSAALRPDALKGARLGVPRKLFDPKRKPMY
EEFERALDLFRQLGAEVVDNADLPSTDEMRVSKAENYVMTCDLKADVNKYLAELEEVPTD
VHTLADLIEWNKAHADIELISPHYDDQSQFVTSEASTIDEAYHEALKKDLELGRNQGIDA
ALEKYNLDALILPKDANASKPAAIAGYPVISVPLGFMPNDTPYAPEEPKPLYQDGPGYPY
GIAFLGTAWSESKLLGYAYAFEQATMVRLKRRAYPEAVPQTQLADVVECT
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatccgagaacgccgcaacgtttccggacttgtacgaggcgtcgatctcggag
ctccagaatggcctcggccagggactctttacgagcgtggaccttgtcaaggcgtatctc
gcgcggatcgaggaggtgaacctcaaaggtgctacgctgcgtgctgtaatcgagacgaac
ccgcctgtgctcgagcaggctaaggcgctcgatgaggagcggagggtcaaaggcccgcgt
gggccattgcatggcataccaatgctgctgaaggataacatcgctactctgcacgaggaa
ggcatgaacaccaccgctggctcgcatgccctcgtcggctccgtcgtcccgcgcgacgca
cacgccgcacacctcctacgcgctgccggcgcgctcttcctcggtaagtcgaacctctcc
gagtgggccaacttccgcgggatcgtgccgtctgggttctcgggacgcggcgggcaggcg
cactgcccgtacgacccctcgggcaagggcgacccgagtggctcgagctcgggcagcgcg
acggccgtcgcggtcggcctgtgcgcaggcgcgctgggcacggagacggatgggtcgatc
gtgagtccgagtagcaggaataatgtggtgggcgtgaagccgactgtggggcttgtttcg
cgtgctggagtgattcccatatcttcgaaccaagacactgcgggacctatgtgtcggact
gttatggatgcgtccctcatcctgtcagctatagcaggtcgcgacactcgggatgcagcg
acgcttgaacagcccgaaaacattccagactattctgctgctctgcgtcctgacgcgctc
aagggagcacggttgggtgttccacgaaagttattcgatccgaaacgcaagccgatgtac
gaagagtttgagagggctctggatttgttccgccagctgggcgcagaggtagtggacaac
gcagatctaccgtctaccgacgagatgagggtatcaaaggcagagaattatgttatgaca
tgcgacctcaaggcggatgtcaacaaatacctcgctgagctcgaggaggttccgacggat
gttcatacactcgccgacctgatcgagtggaacaaagcacacgcagacatcgagcttatt
tcacctcactacgatgatcagtctcaattcgtcacgtcggaggccagcaccatcgacgaa
gcataccatgaggcacttaagaaagatcttgagcttggtcggaatcaaggcatcgacgct
gcgcttgagaaatacaaccttgatgcactcatactccctaaagatgcaaacgcgtcgaag
ccagctgccatagcaggataccccgttatctccgtacccttgggttttatgccaaacgat
accccatatgccccagaggaacccaagcctctgtaccaggacggaccaggatacccgtat
ggaatcgcgtttctaggaacggcgtggagcgagtcaaagcttctggggtacgcgtacgcg
ttcgaacaagcgaccatggttcgcttgaagagacgtgcatacccagaggcagttccgcag
actcagctggcagatgttgtagagtgtacttga

DBGET integrated database retrieval system