KEGG   Coniophora puteana: CONPUDRAFT_146424
Entry
CONPUDRAFT_146424 CDS       T03134                                 

Definition
(RefSeq) ERG4 ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cput  Coniophora puteana
Pathway
cput00100  Steroid biosynthesis
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
Module
cput_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CONPUDRAFT_146424
Enzymes [BR:cput01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CONPUDRAFT_146424
SSDB
Motif
Pfam: ERG4_ERG24 PEMT DUF1295 ICMT
Other DBs
NCBI-GeneID: 19202202
NCBI-ProteinID: XP_007772981
JGI: Conpu1_146424
UniProt: A0A5M3MBH3
Position
Unknown
AA seq 444 aa
MAKTEKDAIAKGGSALNPRTTSYEFLGPPGAFLISVGVPIMTFALYYGCSEETGGCPPTL
DLTTISERVQDAVKNPEWWVSLWDKEAATMYAAWYAFCVVAWAILPGDWIEGVQMRTGGR
KQYKINAFSTFLLAMGIASGFILRNGPEAFTFIYDKWVGFLTAALAMSVFQALYVYAMSF
RSGALLALGGNSGNPIYDWYIGRELNPSVGSLDIKSFNELRPGLILWVLIDLSMVCTQAA
RRGGWAEVTASMWLVLAFQTWYVADALYNEPAIFTTMDITTDGFGFMLAVGDLVWVPFVY
SLQARYLVFEQVELGPYATAGIVAVNLLGYYIFRAANGEKNDFRNGKNPKNLEFFVTKSG
SKLLTSGWWGRSRHPNYLGDLVMAFAWSLPTGFNTPITYFYVMYFAVLLIHRQRRDDEAC
EKKYGEDWEVYKKKVSSRIVPYIY
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggccaaaacagaaaaggacgccatcgccaaaggcggcagcgcgcttaacccgcgcacg
acctcttacgagtttctcggcccccccggcgcgttcctcatctccgtcggtgtgcccatc
atgaccttcgcgctttactatggctgctccgaggagaccggcggctgtccacccacgctc
gacctcaccaccatctcagagcgcgtccaggacgcggtgaagaaccccgagtggtgggta
tccctctgggacaaggaagccgcgacgatgtatgcggcgtggtatgccttctgcgtcgtg
gcgtgggcgattttgccgggtgactggattgagggggtgcagatgaggactggggggagg
aagcagtataagattaatgcgttctcaacgttcctccttgccatgggtatcgcgtccggc
tttatacttcgcaacggccccgaggcgttcactttcatatacgacaagtgggttggcttc
ctcaccgctgctctcgccatgtccgtctttcaagctttgtacgtctacgccatgtccttc
cgctctggcgcgctcctcgccctcggtggaaactccggtaatcccatctacgactggtac
atcggacgcgaactcaacccctccgtcggctccttggacatcaaatccttcaacgagctc
cgccccggcctcatcctctgggtgctcatcgacctctccatggtctgcacacaagccgcg
cgccgcggcggctgggcggaggtgaccgcgtcgatgtggctcgtgctcgcgttccagacg
tggtacgtcgccgacgcgctctacaacgagcccgccatcttcacgacgatggacatcacc
accgacggcttcgggttcatgctcgccgtcggcgacctcgtgtgggtgccgtttgtgtac
tcgcttcaggcgcggtacctcgtgtttgagcaggtcgagctcggcccctatgcgacggcg
ggtattgtggctgtgaatctgctggggtactatatcttccgcgccgcgaatggggagaag
aacgatttcaggaacgggaagaaccctaagaacctcgagttcttcgtcaccaaatccggc
tccaagctcctcacctcgggctggtggggccgctcgcgccaccccaactacttgggcgac
ctcgtcatggcgttcgcatggtcgctgccgaccgggttcaacacgcccatcacgtacttc
tacgtcatgtacttcgccgtgctgctcatccaccgccagaggcgcgacgacgaggcgtgc
gagaagaagtacggcgaggactgggaggtgtacaagaagaaggtttcctctcggatcgtg
ccgtacatctactaa

DBGET integrated database retrieval system