KEGG   Coniophora puteana: CONPUDRAFT_159810Help
Entry
CONPUDRAFT_159810 CDS       T03134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cput  Coniophora puteana
Pathway
cput00450  Selenocompound metabolism
cput00970  Aminoacyl-tRNA biosynthesis
cput01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CONPUDRAFT_159810
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CONPUDRAFT_159810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cput01007]
    CONPUDRAFT_159810
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cput03016]
    CONPUDRAFT_159810
Enzymes [BR:cput01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CONPUDRAFT_159810
Amino acid related enzymes [BR:cput01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CONPUDRAFT_159810
Transfer RNA biogenesis [BR:cput03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CONPUDRAFT_159810
 Prokaryotic type
   Other AARSs
    CONPUDRAFT_159810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f QH-AmDH_gamma
Motif
Other DBs
NCBI-GeneID: 19204188
NCBI-ProteinID: XP_007775131
JGI: Conpu1_159810
UniProt: R7SHG1
Position
Unknown
AA seq 194 aa AA seqDB search
MLKALELPFSRTILTHAHWTVNQRKMSKSVGNVVDPFEAMDIYGVDVVRFYLARVGGRFR
DDVDWSTEQLDKHSDELRTLLGSLFMRITSKAIRAPVEKADENLDIKALLSDTEKAKAAN
AAVNNSAPWAQDPQPAATSYVSVLKTIRVCALCLQPFIPEAAAPLLDAMDVPESERTLRY
AEVKAGAGASRWRV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagcgctggagctgccgttctcgcgcacgattctgacgcatgcgcactggacg
gttaatcagcggaagatgtccaaatcggtgggcaacgtcgtggatccgtttgaggcgatg
gatatatatggggtggatgttgtgaggttctacctcgcgcgtgtggggggacggttcagg
gatgatgtcgactggtcaacggagcagctcgacaagcattcggatgagcttcgtactctg
cttgggagcctctttatgcggatcacatccaaagcgattcgtgcacccgtggagaaagcc
gatgagaacttggacatcaaagcgcttctgtcagacacagagaaggcgaaagctgccaat
gcggctgtgaacaacagtgcaccttgggcgcaggatccccagcccgcggcgacgtcgtac
gtttcggtcctcaagacgatccgtgtctgcgcactgtgtttgcagcctttcatacccgag
gcagccgcgccccttctagacgcgatggacgttccagagagcgagcgtacgttgcgttac
gccgaggtgaaggcgggggcgggggcgagcaggtggagggtgtga

DBGET integrated database retrieval system