KEGG   Coniophora puteana: CONPUDRAFT_162949Help
Entry
CONPUDRAFT_162949 CDS       T03134                                 

Definition
(RefSeq) glycoside hydrolase family 28 protein
  KO
K18580  rhamnogalacturonan hydrolase [EC:3.2.1.171]
Organism
cput  Coniophora puteana
Brite
KEGG Orthology (KO) [BR:cput00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CONPUDRAFT_162949
Enzymes [BR:cput01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.171  rhamnogalacturonan hydrolase
     CONPUDRAFT_162949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 19204816
NCBI-ProteinID: XP_007765543
JGI: Conpu1_162949
Position
Unknown
AA seq 374 aa AA seqDB search
MVCFSLARCLALLGSLTAVLAVTTCDVTDYGGVADNSTDLGPAITKAYSDCVSGATTSDA
SDTVLLVPSGDWAIATAVSLTSVSDFTLEINGAVYLVFNADLTGTIFSFDDCDNIIWQGE
GHIWGNGELWRPDGDLSTYPSRPRLVRFQDCNNVDMSGVALHNAPMFHVTIIGDNNVAHD
MSIIADHIGETDGFDISGNNNYVHDVYVENGDECVTVKTPTNGFVGENIQCYYSAGKRNI
ILNVYYKNVTHSYGDGGIVLKSYPTASGTVKNATYVDFTFSDIAYPIQVSDFWCPNEACP
TTTGDLTWSDITFTDISGTGDDTTRPTIQVECISGYECENIVFNNVDITKEGGATVTIQI
ENACGSGLSEISAC
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggtctgcttctcgctcgcacgctgcttggctctcctcggttcgctgaccgccgtgctg
gcggtgacgacctgcgacgtgaccgactacggcggcgtcgcggacaactcgaccgacctc
ggtcccgcgatcaccaaagcgtactcggactgcgtgtccggagcgacaacgtcggacgcg
tctgacaccgtcctgctcgttccctcgggtgactgggcgattgcgaccgccgtatcgctc
acgagcgtgtcggactttacactcgagatcaacggcgcggtgtaccttgtcttcaatgct
gaccttactgggacgatattcagcttcgacgactgcgacaacattatctggcagggcgag
ggccacatctggggtaacggcgagctctggcgtccggacggcgatctgagcacatacccg
agccgtccccgtctggtgcgcttccaggactgcaacaacgtcgacatgagtggcgtcgca
cttcacaacgcccctatgttccacgttaccatcatcggagacaacaacgtcgcgcacgac
atgtcgatcatcgcggaccacatcggtgaaacggatggattcgacatctcaggcaataac
aactacgtgcatgacgtctacgtcgaaaacggagacgagtgcgtgactgtcaagaccccc
actaacggattcgtcggcgagaacatccaatgctattactcagcaggcaagcggaacatt
atcttgaacgtgtactacaagaacgtcacacactcctatggcgatggtggtatcgtcctg
aagtcctaccccactgcctccggcacagtcaagaacgcaacatatgttgacttcaccttc
tccgatatcgcgtatcccattcaggtgtccgacttttggtgcccgaacgaagcatgcccg
acgacgaccggagacctgacctggtcagatatcacattcaccgacatctccggcaccggt
gacgacaccacgcgcccgaccatccaggtcgagtgtatctccggttacgaatgtgagaac
attgtcttcaacaacgtcgacatcaccaaggaaggcggcgcgacggtcaccatccagatc
gagaacgcgtgcggatccggccttagcgagatctctgcctgctaa

DBGET integrated database retrieval system