KEGG   Coniophora puteana: CONPUDRAFT_58896Help
Entry
CONPUDRAFT_58896  CDS       T03134                                 

Definition
(RefSeq) glycoside hydrolase family 71 protein
  KO
K08254  glucan endo-1,3-alpha-glucosidase [EC:3.2.1.59]
Organism
cput  Coniophora puteana
Brite
KEGG Orthology (KO) [BR:cput00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CONPUDRAFT_58896
Enzymes [BR:cput01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.59  glucan endo-1,3-alpha-glucosidase
     CONPUDRAFT_58896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_71
Motif
Other DBs
NCBI-GeneID: 19207989
NCBI-ProteinID: XP_007769796
JGI: Conpu1_58896
Position
Unknown
AA seq 426 aa AA seqDB search
MIPLSTLTVAAVLCAANAVNAVNVFAHFMAQNSYSYSQSDWANDMTTAKNIGIDGFALNI
AANDYEISPQLGYAFAAAEQADFKLFYSFDMSYSWDAPTIAGIIANYSTSSAAFRYGSDN
NLLVSTYSGENNGDSFYSGLKSTLSGQGINITLAPAFTSYRDPSQADSLMSTFPSIDGFF
NWWSWPADVNANLTTDTDTAYQAAVKSRGGPYIMAVSPWQFKNLDSGGDWVEYSDTLWDY
RWQQALQVQPDIIEIVTWNDYAESHYIGDINPNVDLGTQAPLYVDGFVHAAWRDVAQYYI
SWFKSGNQPTTEEVVYWYRPYPKGVTCSTGSLPRNSDFPADAVFAMAMLSSEATLTLSIG
SQQTNWSAPAGLSMGYVPFPTEDAQVPYFEVSRSGSKVFDGYGSLSVNQTGCSYYNFNPI
VGKVPN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgattcctctctcgactctgactgtcgccgctgttctctgcgcggcgaacgcggtgaat
gcggtgaatgtcttcgcgcatttcatggcgcagaactcctactcctactcgcaaagtgac
tgggcgaacgacatgacgactgccaagaatattggcatcgatggttttgctctgaacatt
gctgcgaatgactacgagatcagcccccagctcgggtacgcgttcgcggctgcggagcag
gctgacttcaagctgttctactcgtttgacatgtcctactcgtgggacgcccccacgatt
gccggcatcattgcaaactactcgacgagctcggccgccttccgctacggcagtgacaac
aaccttctcgtgtcgacctactcgggcgagaacaatggcgactcgttctactcgggcctg
aagagcacgctctcgggccagggcatcaacatcaccctcgcgcccgcgttcacgtcctac
cgcgatccttcgcaagccgattcgctgatgtctacgttcccgtctatcgatggattcttc
aactggtggtcttggcctgccgatgttaatgccaacttgaccaccgacacggataccgcg
tatcaagctgcggtcaagtctcgtggtggaccttatatcatggctgtatcgccgtggcag
ttcaagaacctcgacagcggaggagactgggtcgagtacagcgacactctttgggactac
cgctggcagcaagccttgcaggtccagcctgacattatcgagatcgtgacctggaacgac
tacgccgagtcgcactatattggtgatatcaaccccaacgtggatctcggcacacaggcg
cctctctacgtcgacggcttcgtccacgcggcctggcgtgatgtggcccagtactacatc
tcatggttcaagagcggcaaccagcccaccaccgaagaggtcgtctactggtaccgcccc
taccccaagggtgtaacctgcagcaccggcagcctccctcgcaactccgacttccccgca
gacgctgtctttgcgatggcgatgctcagttcggaggcgaccctcaccctctccatcggc
tcgcagcagaccaactggagcgcgcctgccggcctctcgatgggttatgttccgttcccg
accgaggacgcgcaggtcccatacttcgaggtgagccgcagcggctctaaggtgttcgac
gggtacggctcgctctctgtcaaccagacgggctgcagctactataacttcaacccgatc
gttggcaaggtgcctaactaa

DBGET integrated database retrieval system