KEGG   Coniophora puteana: CONPUDRAFT_64456Help
Entry
CONPUDRAFT_64456  CDS       T03134                                 

Definition
(RefSeq) ferredoxin reductase-like protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cput  Coniophora puteana
Pathway
cput00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cput00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CONPUDRAFT_64456
Enzymes [BR:cput01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CONPUDRAFT_64456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 19208358
NCBI-ProteinID: XP_007773333
JGI: Conpu1_64456
Position
Unknown
AA seq 316 aa AA seqDB search
MFPDKSRSAPVSTTQPLSLAHFTPCFIADTQKTGPDSKLITISVPPVAVLDGTLEKRSPI
WSIYIKDDDIQVERPYTPLEGIDSRGNIKLWIKKYDQGEVGRWLHTKRVGERVDVRGPAE
TWQWKEDTWDDVVMISGGTGITPFYQLVHHVLSSEQISSKTRFTLLHSSKTPEELPPSEV
LSRLINLSDAHPQRFNFRLFVDSIPKITPDRSSGYLFEDTNSDASLGSRSNYDLDVGRIN
KKAIERALDREGSWISRLLGRPSSQVTEGRKVMVLVCGPEPMINAIAGPYGRNYSQGVVG
GVLGELGYKSHQVWKL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctgacaagtcacgttctgcgcccgtttcaacaacgcaaccgctgagcttggct
catttcacaccttgcttcatcgccgacactcaaaagacaggacccgatagcaaactcata
acaatctctgttcctcctgtcgcggtcttggatggaaccttggaaaaacgctcacccata
tggtcaatatacatcaaagacgatgatatacaagtagaacgaccgtatactccactggaa
ggcattgactcgcgaggaaacatcaaattgtggatcaagaaatacgaccagggtgaggtt
gggcgatggctgcacacgaaacgcgtgggagaacgcgttgacgttcgcggtccagcggag
acttggcaatggaaggaggacacatgggatgatgtggttatgatatctggtggaacaggg
ataacacccttttaccaacttgtgcaccacgtactttcatctgaacaaatctcgagcaag
acgcgtttcactctcttgcactcctccaagacacctgaagagcttccaccttcagaggtt
ctgtctcgcttaataaacctcagcgacgctcatccgcaacgatttaacttcaggctcttc
gttgactccatcccgaaaattacgcccgaccgaagttccgggtatctcttcgaagacact
aactcagatgcttcgcttggcagtcgttcaaactatgaccttgacgtaggtcgaataaac
aagaaggccattgagagggctttggacagggaaggctcatggatatcgagactacttgga
cggccttcgtcgcaggttaccgagggaagaaaggtgatggttttggtctgtggccctgaa
ccgatgatcaacgcaatcgccggcccatatgggcgaaattactctcaaggagttgttggt
ggagtattgggcgagcttgggtataagtctcatcaagtctggaaactatga

DBGET integrated database retrieval system