KEGG   Coniophora puteana: CONPUDRAFT_82055Help
Entry
CONPUDRAFT_82055  CDS       T03134                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cput  Coniophora puteana
Pathway
cput00480  Glutathione metabolism
cput01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CONPUDRAFT_82055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cput02000]
    CONPUDRAFT_82055
Enzymes [BR:cput01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CONPUDRAFT_82055
Transporters [BR:cput02000]
 Other transporters
  Pores ion channels [TC:1]
   CONPUDRAFT_82055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-GeneID: 19210351
NCBI-ProteinID: XP_007768393
JGI: Conpu1_82055
Position
Unknown
AA seq 223 aa AA seqDB search
MSSKPLLLYTAPTPNGKKVSVYLEELKAIYGDKVAYDVQKIDISKNTQKEPWFIKLNPNG
RIPVLVDRARGDFPVFETAAILLYLAQHYDTEKKFVFDAATQPNDWSEMLQWMFFAHGGV
GPMQGQANHFNRFAPEDIPYAKKRYIDETKRLYKVMDIRLEGRDYLAGPGRGQCTIADFN
VFPWTKSYSFAGIESIDEFPNFKKWFDRMDAREGVKAGLAVPA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaagccattgctgctctacaccgcccctactcccaacgggaagaaggtctcc
gtataccttgaagaactcaaagccatctacggcgacaaggtcgcctacgacgtgcagaaa
attgacatcagcaagaacacccagaaggagccctggttcatcaagctgaacccgaatggg
cgcatccccgtcctcgtcgaccgcgcgcggggcgacttccctgtgttcgagaccgccgcg
attctcctctacctcgcgcagcactacgataccgagaagaaattcgtgttcgacgccgcg
acgcagccgaacgattggagcgagatgctgcaatggatgttcttcgcgcacgggggtgtt
gggcctatgcaagggcaggctaatcacttcaaccgcttcgcacctgaggatattccttac
gccaagaagcgctacattgacgagacgaaacgtctgtacaaggtgatggacattcgtctc
gaaggccgcgattacctcgccggccctgggcgtggccagtgcaccatcgccgatttcaac
gtcttcccctggaccaagagctactcgtttgccgggattgagtctattgacgagtttccc
aacttcaagaaatggttcgaccgtatggacgcgcgcgagggcgtgaaggcagggttggcc
gttccggcgtga

DBGET integrated database retrieval system