KEGG   Coniophora puteana: CONPUDRAFT_83031Help
Entry
CONPUDRAFT_83031  CDS       T03134                                 

Definition
(RefSeq) Pkinase-domain-containing protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
cput  Coniophora puteana
Brite
KEGG Orthology (KO) [BR:cput00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cput01001]
    CONPUDRAFT_83031
Enzymes [BR:cput01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     CONPUDRAFT_83031
Protein kinases [BR:cput01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   CONPUDRAFT_83031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like Kdo YrbL-PhoP_reg APH
Motif
Other DBs
NCBI-GeneID: 19210514
NCBI-ProteinID: XP_007770051
JGI: Conpu1_83031
Position
Unknown
AA seq 444 aa AA seqDB search
MAPAQSTTVPCQYRTGRTLGSGTYAIVKEAIHIKTGEYFACKVINKKLMEGREYMVRNEI
AVLKRISSGHPNIVTLHDYFETSHNLYLCFDLCTGGELFDSICARGQYTEADAAELVRNI
FRAVKYIHDCGIVHRDLKPENLLFRSKPEKTEQIMIADFGLSRVMPENKLSQLTEICGTP
GYMAPEIFKKTGHGKPVDVWAMGVIAYFLLAGYTPFDRENQRLEMEAILAGDFKFEPEEY
WENVSKTAKDFVSECLTIDPQSRPTAEDCLNHPWLTAEQPHFVENETGQPKDLLPHVRKA
FDARKTFRKAVLGMMAMKRMSTLAHHMSPEAQRLNEEVYNYKQESEKEVMEDMHVAYHHN
ADGSGHHHQQAHSRTHSEAKEAKRVDDISIDNPSETDKTLRSFDGQTPPGKKASEDAQSS
PREGVAEELQKVSLEAKDQKARST
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctgcccagtccaccaccgtgccctgccagtatcgcaccgggcgaacgcttggt
agtggcacttatgccatcgtcaaggaggccatccacatcaaaaccggcgagtactttgcc
tgcaaggtcatcaacaagaagctcatggagggccgggagtacatggtccggaatgagatc
gcggttctgaagagaatatcgagcggtcatcccaacattgtcacgctgcatgactatttc
gagacgtcgcataacctctacctctgcttcgacctgtgcacgggcggtgagctgtttgat
agcatctgcgctaggggccagtacacggaagccgacgccgccgagctcgtccgcaacatc
ttccgcgcagtcaagtacatccacgactgcggcatcgtccaccgggacctcaagcccgag
aacttgctcttccgctcaaaacctgagaagacggagcagatcatgatcgccgactttggc
ctgagccgcgttatgccagagaacaagctcagccagctgactgagatctgtggaacgcca
gggtatatggcccctgagattttcaagaagaccggccacgggaagcccgtcgatgtgtgg
gctatgggcgttatcgcgtacttccttctcgccggttacacgccgttcgatcgcgagaac
cagcgcttggagatggaagctatccttgctggggacttcaagtttgagccggaggaatac
tgggagaacgtgtccaagactgccaaagactttgtctcggagtgtctcaccattgacccg
cagtcacggcctactgcggaagactgtctcaaccacccatggctcaccgccgagcagccc
cacttcgtcgagaacgagacgggccagccgaaggatctgttgccgcacgtcagaaaggcg
ttcgatgcgcgcaagaccttccgcaaagccgtgctgggcatgatggcgatgaagcgcatg
tcgacgctggcgcaccacatgtcgccggaggcgcagcggctgaacgaggaggtgtacaac
tacaagcaggagtcggagaaggaggtgatggaggacatgcacgtcgcgtaccaccacaac
gcggacgggagcggccaccaccaccaacaagcgcactcgcggacgcactcggaggcgaag
gaggcgaagcgcgtggacgatatctcgatcgacaatccgagcgagacggataagacgctg
cgctcgtttgacgggcagacgccgccggggaagaaggcgagcgaggatgcgcagtcgagc
ccgcgtgagggtgtcgcggaagagctgcagaaggtgagcctcgaggcgaaggaccagaag
gcgcggagcacgtga

DBGET integrated database retrieval system