KEGG   Coniophora puteana: CONPUDRAFT_83133Help
Entry
CONPUDRAFT_83133  CDS       T03134                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cput  Coniophora puteana
Pathway
cput00010  Glycolysis / Gluconeogenesis
cput00053  Ascorbate and aldarate metabolism
cput00071  Fatty acid degradation
cput00280  Valine, leucine and isoleucine degradation
cput00310  Lysine degradation
cput00330  Arginine and proline metabolism
cput00340  Histidine metabolism
cput00380  Tryptophan metabolism
cput00410  beta-Alanine metabolism
cput00561  Glycerolipid metabolism
cput00620  Pyruvate metabolism
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
cput01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CONPUDRAFT_83133
   00053 Ascorbate and aldarate metabolism
    CONPUDRAFT_83133
   00620 Pyruvate metabolism
    CONPUDRAFT_83133
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CONPUDRAFT_83133
   00561 Glycerolipid metabolism
    CONPUDRAFT_83133
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CONPUDRAFT_83133
   00310 Lysine degradation
    CONPUDRAFT_83133
   00330 Arginine and proline metabolism
    CONPUDRAFT_83133
   00340 Histidine metabolism
    CONPUDRAFT_83133
   00380 Tryptophan metabolism
    CONPUDRAFT_83133
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CONPUDRAFT_83133
Enzymes [BR:cput01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CONPUDRAFT_83133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 19210532
NCBI-ProteinID: XP_007770215
JGI: Conpu1_83133
Position
Unknown
AA seq 504 aa AA seqDB search
MPGTSFSYDFSSKVYTGKTSFKTGVFINNEFRDGSEGTTIDIMNPVTGGVLTQISEGTAQ
DVDTAVQAAKAALATTWGLKCPGAKRSLLMNKLANLMEEHHDELSALEAVDVGKTFNWAK
NADVAAAIATIRYYAGWADKILGQVIETTEAKLAYTRHEPIGVVGQILPWNFPLLIMCWK
LGPALATGNTAVIKPAEVAPLSCIRMCELIVEAGFPAGVVNMVTGYGHTVGTAITAHNGI
EMVSFTGSTFTGGKVMENAANSNIKDVTLELGGKGPCIVLEDADIDKAANWAAFGVFWSQ
GQVCCAGSRIFVQESIYEKFIARFTQVVRSIKAGDPFGESIWHGPQASQQHFDRIMGYIQ
SGKDEGATVAVGGNRIGTEGYFIEPTVFTDVNPNMRVVKEEIFGPVAVVLKFKDQADAIR
QGNDTEYGLSAAIFSENITKAIETAHQMQAGMTFINCNVSPECQVPFGGIKKSGIGRELG
EYALRSYYTVKAVHVNLGLEMNIG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcacttccttcagttacgacttcagctccaaggtctacaccggaaagacctct
ttcaagaccggtgtctttatcaacaacgagttccgggatggctctgagggcacgaccatc
gacatcatgaaccctgtgacgggtggggtcctgactcagatctctgagggtactgcccag
gatgtcgacaccgctgtgcaggcagcgaaggcagcgttggcgacgacttggggcctgaag
tgccctggtgccaagcgttcgctcctgatgaacaagctcgcgaacttgatggaggagcac
cacgatgagctttctgctctcgaggccgttgacgtcggaaagacgttcaactgggctaaa
aacgcggatgtcgctgcggcgatcgcgacgatccggtactacgccgggtgggcagacaag
atcctgggccaggtgatcgagacgacggaggcgaagctggcgtacacgcgccacgagccg
attggtgtcgtcgggcagatcctgccatggaactttcctctcctgatcatgtgctggaag
ctgggccctgctcttgcgacgggtaacacggctgtgatcaagcctgctgaggtggcgccg
ctgtcgtgcatccggatgtgcgagctgattgtcgaggctgggttccctgctggtgttgtg
aacatggtgactggctacggccacaccgttggcactgcgatcacggcgcacaatgggatt
gagatggtgtcgttcactggatcgacgttcacgggtggcaaggtgatggagaatgctgcg
aacagcaacatcaaggacgtgactctcgagctcggtggcaagggaccgtgcattgtcctc
gaggatgccgacatcgacaaggctgcgaactgggccgcattcggtgtcttctggagtcag
ggccaggtctgctgtgctgggtcgcgtatcttcgtgcaggagagcatctacgagaagttc
atcgcacggttcacgcaggtggtgcggtcgatcaaggctggtgatccgttcggcgagtcg
atctggcacggacctcaggcttcgcagcagcactttgaccgcatcatgggctacatccag
tctggcaaggacgagggtgcgacggtcgccgtcggtggcaaccggatcggcactgaaggc
tacttcatcgagcccaccgtgttcacggacgtcaaccctaacatgcgggtggtcaaggag
gagatcttcggtcccgtcgctgttgtgctgaagttcaaggaccaggcggacgcgatccgt
cagggcaacgacacggagtatggtctgtcggcggcgatcttctcggagaacatcacgaag
gcgattgagactgcgcaccagatgcaggcgggtatgacgttcatcaactgcaatgtgtcg
cctgagtgccaggtgccattcggtggtatcaagaaaagtggtattggtcgtgagcttggc
gagtacgccctccgcagctactacactgtgaaggccgtgcacgtcaacctcggccttgag
atgaacatcggctaa

DBGET integrated database retrieval system