KEGG   Coniophora puteana: CONPUDRAFT_86846Help
Entry
CONPUDRAFT_86846  CDS       T03134                                 

Definition
(RefSeq) glutamate-rich WD repeat containing
  KO
K14848  ribosome assembly protein RRB1
Organism
cput  Coniophora puteana
Brite
KEGG Orthology (KO) [BR:cput00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cput03009]
    CONPUDRAFT_86846
Ribosome biogenesis [BR:cput03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    CONPUDRAFT_86846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 CAF1C_H4-bd eIF2A ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 19211148
NCBI-ProteinID: XP_007763521
JGI: Conpu1_86846
Position
Unknown
AA seq 512 aa AA seqDB search
MAKRTAADLQSTSSQGQAFQKTTAAGAKRDGIDVNDMGEFEDAWEDEIESDEEVVDAEAE
DREDGMDVDEVMPAIEESDEPPSAPQVYIPGQHTLGEDEVLEADDSVYIMRHAMNVTWPC
LSFDILRDSLGDERQRYPATAYVVAGSQAETASKNELTVYKMSSLHKTQRDGDDADSEDE
DDDDNLDEDAILEFRSVPHQGGVNRVRAQPLPPNHPLPPVSQPYLTASWADTGKVHIWDV
RPLIESLDSPGYALDKSRTSKPLYTINSHGRAEGFAMDWASSEGSASSLRLLTGDVHSKI
FLTTVTPSGFNPLSQPFLSHTSSIEDIQWSPSEPTVFASCSADRTVQVWDVRSRGRQSVA
GIDPAHEADVNVISWNKRTDYLLLSGGDEGGIRVWDLRNVKKKGTSASAPTPVASFSWHQ
QPITSIEWHPTEDSIFVASSADNQVTLWDLGVEQDEETEMDASDGTREVPPQLLFSHQGQ
KDVKEAHWHPQIPGTVVSTALDGFNVFKTISV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgcacggcggcagatcttcagtctacatcatcacaaggtcaggcgttccag
aagacaacagcagcaggcgcaaaacgcgatggcatcgacgtcaatgatatgggcgagttt
gaggatgcttgggaggacgagatcgagagcgacgaggaggtggtcgatgcagaggcagag
gacagggaggatggaatggatgtggacgaggtgatgccggccattgaggaatcggacgag
ccaccatcagcaccacaggtctacattcctggccagcacacgctaggggaagatgaagtt
ctcgaggcagacgactcggtgtatatcatgcgccacgcgatgaatgtgacctggccatgt
ctatcgtttgacatacttcgcgacagtctgggggatgagcggcagcgctatcccgctact
gcctacgttgtagccggctcccaggcggaaacggcaagcaaaaacgaactaactgtctac
aaaatgtcttcgcttcataagacgcaaagagacggggatgatgcggactcagaagacgaa
gatgacgacgacaaccttgacgaggatgcaattctggaattcagatcggtaccccaccag
ggcggcgtgaatcgcgtccgagctcaaccactgcctcccaatcatcctttgcctcctgtc
tcccagccgtatcttacggcatcttgggccgatacgggcaaggtgcacatctgggatgta
cgacctttgatcgaatcgctcgattcaccaggctatgctctagataaatcacgaacgagc
aaaccgctgtataccatcaactcgcatggcagagcggagggctttgcgatggactgggca
tcgtcagaaggcagcgcttcgtcgctgcgcctgcttaccggagacgtccactccaagatt
ttcctaacaactgtcactccgtcgggcttcaaccctctttcccagccattcctctcgcat
acatctagcatagaggatatccaatggagcccttctgaacctaccgttttcgcttcgtgt
tctgccgaccgcaccgtgcaagtatgggatgtacggagtagagggcggcagagtgtcgct
ggcatagatcctgcccacgaagcggacgtgaacgtgatcagctggaacaaaagaacagat
tacctcctgcttagtggaggcgatgagggaggtatcagggtttgggacctgcggaacgtc
aagaagaaaggcacgtcggcttctgcaccgactccagtcgcgtcgttctcttggcaccaa
cagcctatcacatcaatagaatggcacccgacagaggattcgatattcgtcgcctccagt
gcagacaaccaggtgacgctttgggacctgggtgtagaacaagacgaggagacggagatg
gacgcaagcgacggcacgcgcgaagtcccgcctcagcttcttttcagccaccaagggcaa
aaagacgtcaaagaggcgcactggcatcctcagattcctggaaccgtcgtcagcacagca
ctggatggattcaacgtcttcaagactatttccgtctag

DBGET integrated database retrieval system