KEGG   Coniophora puteana: CONPUDRAFT_92935Help
Entry
CONPUDRAFT_92935  CDS       T03134                                 

Definition
(RefSeq) P-loop containing nucleoside triphosphate hydrolase protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cput  Coniophora puteana
Pathway
cput03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cput00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CONPUDRAFT_92935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cput03041]
    CONPUDRAFT_92935
Enzymes [BR:cput01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CONPUDRAFT_92935
Spliceosome [BR:cput03041]
 Complex C
  Other components
   Step II factors
    CONPUDRAFT_92935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 Helicase_C OB_NTP_bind AAA_22 DEAD AAA_30 AAA_19 ATPase T2SSE PhoH AAA_29 Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 19211553
NCBI-ProteinID: XP_007773492
JGI: Conpu1_92935
Position
Unknown
AA seq 725 aa AA seqDB search
MSINTPRKKARLPVNGDRPNGKTLASQDLQRQREQLPIAKGRDALVDEIRRNDVTILLGE
TGSGKTTQIPQYIIDSGIAGGGVVAVTQPRRVAATSLAARVAAEQDVQLGDLVGYSVRFD
EVASPSTRIKYLSDGMLVRELLSDPILSRYSVIIVDEAHERTLRTDFLVANLKAILAKRN
GGGGTHTVTNGQSDAKGKGKKRAVENPLKVIIMSATLDAEKFSRFFNNAKVLYVKGRQHP
VQTFHTSVSQIDYVDAALRTFFQIHIDKGPGDVLIFLPGQEDIESLEKSIQSYTRRLPEN
CLNVLVYPMFAALPPAQQAKIFSSTPSGSRKCILATNIAETSITIPGIRYVIDTGKCKEK
RYLSRDTGGGFDTLLTQDITKSSAMQRAGRAGREGPGFCFRLYTEDAFNAMAASAEPEIR
RCSLTQSVLELKCLDYDLETVEFMDMPESEAIFSALKTLFLLGALDRTKALTHLGRSMAA
LPLEPYLARIVLASKAHACTAPVLDIVSILSASSKLFVDVSEARDAAAEARRKFRHPSGD
HLTLRNALKAYEDLLEGGKDDMDVDDARDGMEVVQSSNHGQGQDGKKGSKASKAARREWC
RANFLNEKTLMEAMKIRTQLRGNCERLGLDWRTEPAGASGEEAVLRCFVAGLQQQAAFLQ
PDGTYKQVVGQSIVKIHPGSTLGDRKAPAIIYDELIYTSQIYARGVSSVPRSFFSGMTSS
TYGTT
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtcgataaacaccccacgcaagaaagcaagactcccagtcaatggagaccgtccgaac
gggaaaacacttgccagccaggacctacagcgtcagcgcgagcagcttccgatagctaag
ggtagagatgccctcgtcgacgagatccgacggaatgatgtgacgattctactcggagag
acaggatctgggaagaccactcaaataccgcaatatatcatcgattctgggattgcaggc
ggtggtgttgttgctgtcacacaaccccggagagttgcagctacctccctggctgctcgc
gtcgctgcggagcaggacgttcagctcggcgatctagtcggctattccgttcggttcgat
gaggtggcgtctcccagtacacgtatcaagtatctttcggatggtatgctcgttcgcgag
ctcctctcggacccgattctctcgagatacagcgtcatcattgttgacgaggcgcacgaa
cgaacactacggacagacttcttagttgccaatctgaaggcaatattggcaaagcgaaac
ggaggtggaggaactcacacagtcacaaacggtcagagtgatgccaaaggaaaggggaag
aagagagctgtggagaacccgctcaaggtgatcatcatgagtgctaccctcgacgcggag
aagtttagcaggttcttcaacaatgctaaggtgctctacgtgaagggtcgccagcatccc
gtgcagacgttccacacgtcagtaagccagatagactacgtcgatgctgctctacggaca
ttcttccagatacatatcgacaaaggtcctggggacgtcctcatatttcttccaggccag
gaggatattgagagccttgaaaagtcgatacagtcctacacgcgccgtttacctgaaaac
tgtttgaatgtcctcgtatatcctatgtttgctgctctcccaccagcacagcaggcaaaa
atattctcttcgacccccagcgggtcacggaaatgtattcttgccacgaatatcgcggag
acctctatcacgatacccggcataaggtatgtcatcgatacagggaaatgcaaggaaaag
cgatatctatctcgggatactggagggggatttgacactttactcactcaagacatcacc
aaatcttccgccatgcaacgagcgggtcgtgcaggtcgtgagggacctggattttgtttc
agattatacaccgaagatgccttcaacgcaatggctgcatccgcagagcctgagattcga
aggtgtagtcttacacagagtgtactagagctcaaatgcctcgactatgacctggagacc
gttgagtttatggatatgccagaatctgaagccatattttcagccttgaagaccctcttc
ctcctcggggccctggaccgaaccaaggccctcacgcacctaggacgctccatggccgca
cttccactggagccgtatcttgcgcggatcgtgctcgcctccaaagcacacgcatgcact
gcacctgtgcttgacatcgtctccatcctctcagccagctcgaaacttttcgtcgacgtg
agtgaagcgcgcgacgcagccgccgaggcccggcgcaagttccggcacccaagcggagac
caccttacgcttcgcaatgcgctcaaggcgtacgaggatctgttggaaggcggtaaagac
gacatggatgttgacgatgctcgtgatgggatggaggttgtgcaaagcagcaaccatgga
caggggcaggacgggaagaagggaagcaaggcgagcaaggccgcccgacgggagtggtgt
cgcgccaattttctgaatgagaagacgcttatggaggcgatgaagattcgaacgcagctg
cgagggaactgcgagcggctcgggctcgactggcgcacggagcctgcgggcgcatcgggc
gaggaagccgtgctcaggtgttttgttgctgggctgcaacagcaagcggcgtttttgcag
ccggacgggacgtataagcaggttgttgggcagtcgattgtcaagatacatccgggctcg
acgcttggtgaccggaaggcgccggccataatttatgatgaactaatctatacgagccaa
atctatgctcgtggtgtctcgtctgttcccagaagctttttctccggtatgacatcctcg
acgtacggcacaacatag

DBGET integrated database retrieval system