KEGG   Coniophora puteana: CONPUDRAFT_97215Help
Entry
CONPUDRAFT_97215  CDS       T03134                                 

Definition
(RefSeq) Ureohydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cput  Coniophora puteana
Pathway
cput00220  Arginine biosynthesis
cput00330  Arginine and proline metabolism
cput01100  Metabolic pathways
cput01110  Biosynthesis of secondary metabolites
cput01130  Biosynthesis of antibiotics
cput01230  Biosynthesis of amino acids
Module
cput_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cput00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CONPUDRAFT_97215
   00330 Arginine and proline metabolism
    CONPUDRAFT_97215
Enzymes [BR:cput01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CONPUDRAFT_97215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 19211804
NCBI-ProteinID: XP_007764521
JGI: Conpu1_97215
Position
Unknown
AA seq 315 aa AA seqDB search
MSSPANKFLSSPKTVAIVGCPFGGGGIPTKAGVDKGPSHIVDAGLVTQLEELGWKVEFDG
HQRFESLVPENDPPIGKLKNPRTVSAVCESVAKVVGGHARAGRLPVSLGGDHSLAMGTIS
GTLDAYPDACVIYVDAHTDINTVATTDSGNMHGMPVSFLMGLSSGVDAFAWLKGALRPER
MVYIGLRDLDASEKRILRENSIRAFSMRDVDRHGICRVVGMALDRVNPDRDRPIHLSFDI
DALDPSVAPSTVLPVQGGLTFREGHSVCDAIHETGLLVALDLVEVNPSIGDVKDVQQTVR
VACSLIRTALGETLV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccctgctaacaagtttctctcaagccccaagactgtcgccatcgtcggttgt
cctttcggagggggcgggataccgactaaagctggtgtcgataaaggtccgagccacatt
gttgacgcaggtctcgtcacccagcttgaggagcttggttggaaggtggagtttgatggg
caccagcgcttcgagtcgctggttccagagaacgatccgcctatcggcaaactgaagaat
ccgcggacggtctcagccgtgtgcgagtccgtggcaaaggtcgtgggagggcacgccaga
gctggacggctgcctgtctcgctcggaggcgatcattctcttgccatgggtaccatatct
ggaactctggatgcttaccccgatgcgtgtgtcatctatgtcgacgctcacacagacatc
aacacagtcgccaccaccgacagcggaaacatgcacggcatgcccgtctccttcctcatg
ggcctcagcagcggggtcgatgcgttcgcgtggctgaagggcgccttgcgtcccgagcgg
atggtgtacatcggcctgcgcgatctcgacgcgagcgagaagcggatcctgcgcgagaac
agcatcagggcgttcagcatgcgcgacgtcgacaggcacggtatctgccgcgtcgtcggc
atggcgctcgaccgcgtcaatccggacagggacaggccgatccacctcagcttcgacatc
gatgcgctcgatccgtctgtggcgccttcgacggttttgccggttcaaggtggtcttact
ttccgtgaaggacatagcgtatgtgacgcgattcacgagacaggcctgttggtagccctt
gacttggtggaggtgaatccttccatcggggatgttaaagacgtgcaacagacggttaga
gtcgcatgctcgctgatacgcaccgctcttggcgagactctagtgtga

DBGET integrated database retrieval system