KEGG   Cryptosporidium parvum: cgd1_3310Help
Entry
cgd1_3310         CDS       T00168                                 

Definition
(RefSeq) cyclin domain protein, possible cyclin H
  KO
K06634  cyclin H
Organism
cpv  Cryptosporidium parvum
Pathway
cpv03022  Basal transcription factors
cpv03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    cgd1_3310
  Replication and repair
   03420 Nucleotide excision repair
    cgd1_3310
Transcription machinery [BR:cpv03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     cgd1_3310
DNA repair and recombination proteins [BR:cpv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     cgd1_3310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 3371454
NCBI-ProteinID: XP_628145
ApiDB_CryptoDB: cgd1_3310
UniProt: Q5CSC2
Position
1
AA seq 227 aa AA seqDB search
MSVYPSESHHLKEWVFGSLDLLKTKKNYINEKAKENWKDIFRQISSENFEINELLLTSKD
EETLISYYGRQLIEFCNHKQLPFVSKYNASILYHRFFTNQSVMDYDPRIIIFTSISLALK
LEEFGLHFTLEKLFGDVPGLNIQEVFRHELTVCNTLKFHLYILNPRNTLEGLRLLYKKYY
IDILVVDENLDNNDHKKTENKKNQLISLLSKVILKAETYVLMILHTL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgtatccatctgaatcacatcatttgaaagaatgggtttttggatctttagat
ttattaaaaacaaaaaaaaattacattaatgagaaagcaaaagaaaattggaaggatatt
tttagacaaatttcgagtgagaattttgagattaatgagttgttattaacatcaaaagat
gaagaaactttaatttcttattatggtagacaattgatagaattttgtaatcataaacag
cttccatttgtttcaaaatataatgcatcaatattatatcatagattttttactaatcaa
agtgtaatggattatgatcctagaattataatatttacaagtatatcattagcattaaaa
ttagaagaatttggacttcattttacattagagaaactttttggagatgtcccaggtttg
aatatacaagaagtttttagacatgaattaactgtgtgtaatacattaaaatttcattta
tatatattaaatccaagaaatacattagaaggtttaagacttttatataaaaagtattat
atagatattttggtagttgatgagaatttggataataatgatcataagaaaactgaaaat
aagaaaaatcaattaataagtttattatcaaaagttatattaaaagcagaaacatacgta
ttaatgattttacatacattgtaa

DBGET integrated database retrieval system