KEGG   Cryptosporidium parvum: cgd2_2680
Entry
cgd2_2680         CDS       T00168                                 

Definition
(RefSeq) possible MgtA, cation transport ATpase, signal peptide, 12 transmembrane domains
Organism
cpv  Cryptosporidium parvum
Motif
Pfam: Hydrolase E1-E2_ATPase Cation_ATPase
Other DBs
NCBI-GeneID: 3373632
NCBI-ProteinID: XP_626470
ApiDB_CryptoDB: cgd2_2680
UniProt: Q5CTJ9
Position
2
AA seq 1434 aa
MDNIFEWLLYLQKCGFFIISTVLLFHLMLAICYQIRTKHVNKGKTGLFQIVGLKKSFFGE
FLRQIEIFFLIFYPFVFHVSVVAIMFYKSYTQTFESSFNWHEAVKIYARSLLTVIFCIVF
LKLLKAKYGSFEQIFLVPEDLSDCEFISISFPGSCRFSKNNIWCKLFGNYYIRVLEKFPV
TKLCRIIKRSEPINFFGTETDRYFEYRREKYWWYENEFTWSREILSRKAAESFPVENTDF
LKVRDQVIESFGNHDKDKILEFVGTNSLGSYPLSLWKLIFSEFTSVLNIIRIMTLLDALF
YSFIVWPLCWSIITFYTISWSIIKSRRNYIETEKVLTQHDWDIYRYLTGPYKPHSYSNAG
SSFVLSKELFPGTVIFIDKAMRIPADLLLLNGNVVVDESCLTGEATPQCKTGGIQIAPSE
FSLACDVLSNSRHLYAGSQVLEVSSTGITLAMVTRTGSATLHGTFTSGHSNANDEHGFTE
GLPPLLTSNSRRDFTSESISSLGRHCDLYKSIKRNWNFTPEPLWILCFIYGTFIALTDSY
TLSFEIGSIFFIVSTIIYIIPFWSTSSMSLYFNNAIKYLNSEHILTTNPKKLNQLLLVDT
ICFDKTGTLTVPTFSINNVHIYPIRNNTRDHLMHLAMATCNNLIFEKAGPLQLTRKNSFS
CPSGSKLEQCLYNYSGFCGYKVFTFSSERLFIIPLCNRKTFLERVIELESHLILDYGASF
DIQQLDNVYPKNSLEYISAVCDAVEITKRYPFDETLRSQSVAIKKYSIESELSSNLYCIR
STSMLFMKGAAEKIVELTTNYDDCSDGTSFRDWSNDILENQVAGSYILGYCYKVVNDQAN
SSNNTLSYKHLSSSFIPLGLAQLHSPIRPEAKLVLKLLKNGNFHCPIITGDNINSAIVVA
KELGMIFNRFASCYIDLENNLVWEIENSKRKVKFSLKNKNKIRALSGIIPQQIIQDKFQI
ALSSDAFKLFINILNLETYAGYKRKAPDELIELSIFSKIIYNTAIFARFTPELKSMAVEL
LERLGMTVLMVGDGPNDIIALQKANSGLLITETIKCNGLVAPFISEIFPYGLHSVCRLVI
ESRGVVFAFVSMYQHIVLLGIFFVTCKTFLLWQSQAMIPAMAWLFIDIFCTLLPLLLFSF
SRPKEYKIKNVNTTINHPSHDITSSHYPETCNSDCVNTRIKNLNTYAIDVNSDKYMLLVD
NESPSALINKQIYNIKSHVGFHTFYTASFLSLLISLLGFFVISNRLVHFVLPKHGIERCF
RYNLTIPVYLWHIRQDNIEAASSWCYISFQLVNQVWPIWLRSSSLIPMKTNILLIIWNIT
MNFFILFCIWMEPSRLGCILRINCDDQTSRSLPDNWIKLSSPFYGQYNNNIFPKFWKIEL
TFWCVFFLMLNVIISIALRTVIFKFRDFEQIKAPNPSKTTSNRTESSLNENVGT
NT seq 4305 nt   +upstreamnt  +downstreamnt
atggataatatctttgagtggttactatatctacaaaaatgtggattttttatcatttca
actgttttgttgtttcacttaatgttggctatttgttatcaaattagaacaaagcatgta
aacaaaggtaaaacagggttattccaaatagttggtttaaaaaaatctttttttggagaa
ttcctcagacaaattgagatattttttttgattttttacccattcgtttttcatgtttct
gtagtagcaattatgttttacaaatcgtatacacaaacatttgagtcttcgtttaattgg
catgaagctgtgaaaatttatgctagaagtttattgactgttatattttgtattgtcttt
ttaaaattactgaaagcaaaatatggatcttttgaacaaatattcctagtacctgaggat
ctttctgactgcgaatttatctctatcagcttcccaggatcttgtagattttcaaaaaat
aacatatggtgcaaattatttggtaattattatattcgtgttttggaaaaatttccagtt
actaagctctgtcgtatcattaaaagaagcgagccaatcaacttttttggtacagagact
gatagatactttgaataccgtagagagaaatactggtggtatgaaaatgaattcacttgg
tccagagaaattttgtccagaaaagccgctgaaagttttcctgtagaaaataccgacttt
ctaaaggtaagggaccaagttattgaatcctttggaaaccatgataaagataaaattctt
gaatttgttggaactaacagcttaggctcataccctctttcactatggaaactcattttt
tctgagtttacctcagttttaaacattattcgtattatgacattattagatgcgcttttt
tattcatttattgtctggcctctttgttggtccataattacattttatacaatttcttgg
tcaattattaagtccagacgtaattatattgaaacagaaaaagtgcttactcaacatgac
tgggatatttatagatatcttacagggccatacaagccccattcatattcaaatgccggt
agctcctttgttttgtcaaaagaactttttcctggtacagtcattttcatagacaaggcc
atgcggatccctgctgacttattactgcttaatgggaatgttgtggtagatgaatcatgt
cttactggtgaagcgactccacaatgtaagacaggtggaattcaaattgctccctctgaa
ttttccttagcctgcgacgtgctatctaattctaggcatctttatgctggcagccaagtt
ttggaagtttcatcaactggcataacgctagctatggtaacaagaacaggatcagctaca
cttcatggaacatttacctcaggccattctaacgccaatgacgaacatggatttactgaa
ggattgcctcctctcttaacatcgaactcaagacgtgactttacttcagaatcaatctca
tcattaggtaggcattgcgatctttacaaaagcattaaaagaaattggaattttactcca
gaacctctttggattttgtgtttcatatacggaacttttattgctttaaccgattcatat
actttatcttttgagatcggctcgatatttttcattgtttcgacgataatttatatcatt
cctttttggtctacttcttccatgtctttgtactttaacaatgcaatcaagtatctaaac
agtgaacatattctaacaacaaatcccaaaaaattaaatcagctgctccttgtagataca
atatgttttgataagacaggtactttaactgtccctacgttttcaattaataatgtacat
atctacccaattagaaataatacaagagaccatctaatgcatttggcaatggctacatgt
aataatttaatatttgaaaaggcagggccactacagttaacaagaaagaactccttcagc
tgcccttctgggtctaaactagaacaatgtttgtataactactcaggtttttgtggctat
aaagtatttacttttagctctgaaaggctttttattattcccttatgtaatagaaagact
ttccttgagagggttatagaacttgaatctcatctaattttagactacggggcaagcttt
gacattcaacagcttgacaatgtttacccaaaaaattcacttgaatatatttctgctgtt
tgtgatgcagtcgagataacgaaaagatatccgtttgatgaaacactaagatctcaaagt
gtagctataaagaagtattcgattgaatctgaactttcttcaaacttgtattgtattcgc
tctacatctatgctctttatgaaaggtgcagcagagaagattgtggaattaacaaccaat
tatgacgattgtagtgatggaactagtttcagagactggtctaatgatatactcgagaac
caagtcgcaggttcatacatccttggatactgttataaagtggtaaatgatcaagctaat
tctagcaataatactctttcctataagcacttaagctcatcttttattcctcttgggtta
gcccagctacattctcctataaggccagaagcaaaattagttctcaagctgctgaagaat
ggtaattttcactgccctattattacgggagacaatattaattcagcaatcgttgttgca
aaagaacttggtatgatttttaatagatttgcttcctgttacattgacctggagaataat
ttagtttgggaaattgaaaattcaaaaagaaaagtcaaattttctttgaaaaataaaaac
aaaattcgtgcattatcgggcattatacctcaacaaattattcaagataaatttcaaatt
gcactatcatcggatgctttcaaactatttattaatatccttaatttggaaacgtatgct
ggctacaaacgcaaagctccagatgagctaattgaattatctatattttcaaaaatcatt
tataatactgccatttttgccagatttactcctgaactgaaatctatggcggttgaacta
cttgaaaggctaggaatgactgtacttatggttggtgatggtccaaatgacattattgca
ctacagaaagcaaactcaggtcttttaataacagaaacaattaaatgtaatggccttgtt
gctccatttatttcagagattttcccatatggtttacattctgtttgtagactagtaata
gagtctcgaggcgttgtttttgcatttgtatcaatgtatcaacatatagttttgcttgga
atattcttcgttacatgcaaaacctttctcttatggcaatctcaagcaatgatacctgct
atggcatggcttttcattgatattttttgtactttacttccactattgttgttttcattt
tccagaccaaaagaatataaaataaagaatgtgaatacgactataaatcatccttcgcat
gatattacgagcagccattatcctgagacttgtaactcagattgcgtcaatacaagaatt
aaaaacctaaatacttatgctattgatgtgaattccgataaatatatgttattggttgac
aatgaaagcccatcagcactgattaataaacagatatataacattaagagccatgttgga
ttccacactttttatactgcaagttttctatctctgctcatttctttactaggttttttt
gtcatttctaacagactagttcacttcgttctcccaaagcatggaatcgaacgttgtttc
aggtacaatttaactattccggtttacctttggcacattagacaagataatattgaagcc
gcttcgtcctggtgttacatttctttccaattagtcaaccaagtatggccaatttggcta
cgttcatcttctcttattccaatgaaaaccaatattcttctaattatatggaatattact
atgaattttttcattttgttttgcatctggatggagccgtctcgattaggttgtattctg
agaattaactgtgacgatcaaacttcaagatcgctcccagataactggattaaactttct
tcaccattttacgggcaatacaataacaatattttccctaaattttggaaaattgaactt
accttttggtgtgtttttttcttaatgcttaatgtcatcatttccatagcattgagaacc
gtgattttcaaatttagagattttgagcaaattaaggctcctaatccctcgaagactaca
tccaatagaaccgaatcctctctcaacgaaaatgttgggacgtaa

DBGET integrated database retrieval system