KEGG   Cryptosporidium parvum: cgd3_2620
Entry
cgd3_2620         CDS       T00168                                 
Name
(RefSeq) DNA-directed RNA polymerase,possible RNA polymerase A/beta'/A'' subunit, long PHYSPTS repeat
  KO
K03006  DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
cpv  Cryptosporidium parvum
Pathway
cpv03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:cpv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    cgd3_2620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cpv03021]
    cgd3_2620
   03400 DNA repair and recombination proteins [BR:cpv03400]
    cgd3_2620
Enzymes [BR:cpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     cgd3_2620
Transcription machinery [BR:cpv03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     cgd3_2620
DNA repair and recombination proteins [BR:cpv03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      cgd3_2620
SSDB
Motif
Pfam: RNA_pol_Rpb1_5 RNA_pol_Rpb1_1 RNA_pol_Rpb1_2 RNA_pol_Rpb1_6 RNA_pol_Rpb1_3 RNA_pol_Rpb1_7 RNA_pol_Rpb1_4 RNA_pol_Rpb1_R
Other DBs
NCBI-GeneID: 3373777
NCBI-ProteinID: XP_626822
ApiDB_CryptoDB: cgd3_2620
UniProt: Q5CUJ2
Position
3:662428..668136
AA seq 1902 aa
RRIIQEIMSTALELNSPFSSKELKRVFSIEFGVLSPELIRKYSVLEIKVSDIYENGRPKS
GGLNDPLLGTTDYHILCETCHMDIKTCPGHFAHIELGKPMFHIGFITTVLKLLRCVCYAC
SKLFVDTLDPKFKQIKRIKNPRLRLKKILEMRSSSSRCIISSDGSGCGFVQPTYSKEGYN
LYINQNQDENRIIDDESVDSKRLLAAEEVLTIFKRISHDDMKILGFDPVKCNPSWFINTV
IPIPPPAVRPYVQFGSDRSEDDLTLKLQQIIKLNENLKKQIRIGSPEHIISEMSTVLQYH
LITLINNDLPGLPQSRTRSNRPIKSLRARLKGKDGRIRGNLMGKRVDFSARTVITGDPNL
AVDQVGVPYSIAMTLTYPEVVTPYNIEELKELVQRGPHEWPGATSIIQEDGTKVDLRFSN
TSNNSNNILQYGWKVERHMKNDDLVLFNRQPSLHKMSIMGHRVKILPYSTFRLNLSVTSP
YNADFDGDEMNLHLAQSHETRSEIKNLMMVPRQIVSPQGNKPVIGIVQDSLLGIFLLTRK
STFLTRDKFLQLLLCIPYWNGNIPPPAILRPQPLWTGKQIITVLLAFTTDLGEPIELNLM
RDGSIVSIKQSNNSSNTDKDDSKEAIVNNPWISELDNQVIIQKGEHICGVLTKKIAGSSS
GSLIHILWNEIGPEKTGLFLTYTQMVVNTWLLEHGFTVGCQDIQPQNYTLEKIMNSLEGS
KLQVQQIIRRAQKGKLDCQPGKSLIESFEAQVNQELNSARELSGTIATENLDSSKNNIVA
MVQCGSKGSTINISQIMACVGQQNVEGKRIPFGFRDRSLPHFLKYDYGPESRGFVSNSYL
SGLTPQEVFFHAMGGREGIIDTACKTSETGYIQRRLIKAMEDCMVQYDRTVRNSNGDIIQ
FLYGEDGMAGEFIEDQVIELLQMEAAVFQHKYRHNLEHPRWGSSWAGVQPSLIKNLQFDL
ESQNILNSEYKQLVTDREQLGKDIFPDGETRQHLPININRIIQMAQQKFPQRVSDTSSSK
DWGPVYIIKKVESLLDKLLLWKNVGIINDEGNKSNFVFDSIIAEVQKNATTLLGIHIRSS
LASKKILEVDRLGPTAFEWILGEIEHQFYRSLAHSGEMVGTIAAQSIGEPATQMTLNTFH
FAGVGSKNVTLGVPRLRELINVAKNVRTPTLTVYLESGIANDQEQAKDVLTLLEHTMLQN
ITTIAHILYDPEQDKTIVEADKSWVSDYYEFPDDADITSRLGTWLLRIQLNNKLVTDKKL
SMKEIGDKILMEFSKDELDCIWTDDNSDELVLRLRIKNIEPTNNIRDNIHSSEENDSISP
SITSGVEEHKFLEKLMTECLSQITLRGINNIKKVYMKEEQVSRYDSVSQKMVRDNQWVLD
TDGCNLEAVLCHTAIDSTRTISNDITEVFSVLGIEAVRRALLRELRTVISFDGSYVNYRH
LALLCDNMTQKGHLMSITRHGINRVDKGPLQKCSFEETVEVLMDAAMFGETDYLNGVSEN
VMLGQLAPYGTACFDVLIDPDKLRDTATHLEIHGEFAKLGKFSTLSQTTRSYSDSGAFES
DSFESPMSPLSPMSPLYQSYEPMSPMISGQFSPVQMTPRSPMSPVSPGGIFSPVPYSPMS
PSSPLMDYTPTSPIYAASSPTYNTEVSERARKKYKVNNTLSSYSPSSPLNSDNKISNISP
DLSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSP
TSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPTSPHYSPSSPH
YSPTSPQYSPTSPNYNPASPNYSPTSHYSPTSPNYNPTSPNYSPSSPNYISNNSGSPGYS
PSSPQYDPIAVASVPRSPSYSVGKMVDAEYSPSSPLDETKNS
NT seq 5709 nt   +upstreamnt  +downstreamnt
aggcgaattatccaggaaattatgtccacagcattggagttgaactctccatttagcagt
aaagagttaaaaagagtatttagtatcgaatttggcgtcctttcacccgaactaatacgt
aagtattccgtactcgagattaaagtatcagatatttatgaaaatggaagacctaaatca
ggtgggcttaacgacccattgttgggcacaacagactatcatattctttgcgaaacttgt
catatggatataaaaacatgtcctggccactttgcgcatattgagcttggaaagcccatg
tttcatatcggatttattactacagtacttaagcttctcagatgcgtgtgctatgcatgc
tctaagttattcgttgatacattagatcccaagtttaaacaaataaaacgcattaagaat
ccaagacttagattgaagaaaattctagaaatgagaagctcttcatccagatgtataatt
tctagtgatggttctggatgcgggtttgtccaaccaacctattcgaaagaaggatataat
ttgtatattaatcaaaatcaagatgaaaacagaattattgacgatgaaagtgttgattcg
aagaggttgctagccgcagaagaggtacttacaatttttaaaaggatatctcacgatgac
atgaagattcttggatttgatcctgtaaaatgtaatccttcttggtttattaatacggta
ataccgattcctcctccagctgttagaccatacgttcaattcggaagcgatcggagcgaa
gatgatttgactttaaaactacaacaaataatcaagttgaatgaaaatcttaaaaaacag
attcgtattgggtctcctgaacatattattagtgaaatgtcaactgtacttcaatatcat
ttaattacacttattaataacgacttacctggtttgcctcaatctagaacaaggagtaac
aggccaatcaaatctctcagagcacgtctaaaaggcaaggatggtcgcatacgcggtaac
ttaatgggtaaaagggtagatttctctgcaagaacagtaataacaggcgatcctaactta
gctgtcgaccaagttggagttccatattctattgctatgacacttacttatcctgaagtt
gttacaccatataatatagaagagctaaaggagttggtgcaaagaggaccgcatgaatgg
ccaggagcaactagtattattcaggaggacggaacaaaggttgacctaaggttttcaaat
acctcaaataattcgaataatattcttcaatatggatggaaggttgaaaggcatatgaag
aatgatgatctagtgctcttcaacaggcagcctagtctacataagatgagtattatgggt
catcgtgtaaaaattttaccttattctacatttagacttaatctttcggtaacttcgcca
tataatgcagactttgatggagatgaaatgaaccttcacctggcgcaatcgcatgagacc
cgatctgaaatcaaaaacttgatgatggttccgagacaaatagtttctcctcaaggtaac
aaacccgtaataggcatagttcaggattcattacttggaatttttcttctaacgagaaaa
tcaacctttttaactagagataaatttttacagctcttattatgtattccttattggaac
ggaaacatccctcctcctgcaatacttaggcctcagcctttatggactgggaaacagatt
attacagtgctacttgcatttacaacagacttgggtgagccaattgaattgaatttaatg
cgagatggtagtattgtatcgattaagcaatctaataactcttctaatacagataaagat
gattctaaagaagctatagttaacaatccttggatatcagagctggataatcaagtaata
atccagaagggagagcatatttgcggagtactcacaaaaaaaattgcagggtcttcttca
ggttcactaattcacattttatggaatgaaattggcccagaaaaaactggattgtttttg
acgtatactcagatggtagttaatacatggcttcttgagcacggcttcactgtaggatgt
caggacattcaaccacaaaattataccttggaaaaaataatgaactctttagaaggctca
aagttacaagttcaacaaattatcaggcgcgctcagaaaggtaaacttgattgtcagcca
ggtaagagcctaattgaatcttttgaggctcaagttaatcaggaattgaatagtgcgcgt
gagttgtctggtacgattgcaactgagaacctcgattcttctaaaaacaatattgttgca
atggtccaatgtggaagcaaagggtcaactataaatatttcacagattatggcatgcgtt
gggcagcaaaatgtcgaaggtaaacgtattccatttgggtttagggatagaagcttgcca
cattttttgaaatatgattatgggcctgaaagtcgtggttttgtttcgaactcatatctt
tcaggtcttacaccccaggaagttttttttcatgctatgggaggcagagaaggaatcatt
gatactgcttgtaaaacttcagaaacagggtatatacaaagaaggctaataaaggcaatg
gaagattgtatggtacagtatgatagaactgttaggaatagtaatggcgacattattcaa
tttctttatggagaagatggaatggcaggagagtttattgaggaccaagttatcgaacta
ctacagatggaggcagcagtgttccagcacaagtatcgtcacaatcttgaacatccgaga
tggggttctagctgggctggtgtccaaccttccttgataaaaaatctacaatttgatcta
gaatctcagaatatactgaactccgagtataaacaacttgtaacagaccgcgagcagctt
gggaaagacattttcccagatggtgaaacaagacaacatcttccgattaatatcaataga
ataattcaaatggctcaacaaaagtttccacaaagggtaagtgatacgtcatcgagcaag
gattgggggccagtttacatcataaaaaaggttgaatcattgcttgataaactattgctt
tggaagaacgtcgggattatcaatgatgaaggcaataaatctaattttgtatttgatagt
attattgctgaagttcaaaagaatgccacaactttgctagggatacatattagaagctct
ttagctagtaaaaaaatattagaggttgataggcttggaccaactgcatttgagtggata
cttggggaaattgaacatcagttttatagaagtcttgcacactccggtgagatggttggc
actatagcagcacagtcaattggagaacctgcaacgcaaatgacattaaataccttccac
tttgctggtgtgggctcaaaaaatgtaactctcggtgttccaaggctgagagagctaatt
aatgttgcaaaaaatgttagaacaccaaccttaactgtttatcttgaaagcgggattgca
aacgaccaagaacaggcaaaagatgtattaacattattagaacatacgatgctacaaaac
attacgactattgcgcacattttatatgacccagaacaagacaagactattgtcgaagca
gataagagttgggttagtgattattatgaatttccggatgatgcggatattacaagcaga
cttggtacttggctattaagaattcagttgaataacaagcttgttactgacaaaaaactg
tcaatgaaagaaattggtgacaaaattttaatggaatttagtaaagatgagttggattgt
atttggactgacgataactcagatgagcttgtattaagactccgaattaaaaacattgaa
cctaccaataatattcgcgataatatacattcttctgaagaaaacgactcgatttctccc
tcaattacgtcaggagttgaagagcataaattcctggaaaaactaatgacggaatgtctt
tctcaaattacccttagagggataaacaatattaagaaggtttatatgaaagaggaacag
gtttctagatatgatagtgttagtcagaaaatggtgagagacaaccaatgggtgcttgac
acagatgggtgtaatcttgaagcagtgctttgccacacagcaatagatagtacaagaaca
atctcaaacgatataactgaagtctttagtgtattagggatcgaagccgtaagaagagct
cttcttagagagttgagaacagtaatttcatttgatggaagttatgtaaactataggcac
ttagcactactctgcgataatatgactcaaaagggccacttaatgagtataacaagacat
ggtatcaatagagttgataagggcccgcttcaaaagtgcagttttgaagagacagttgaa
gtcttaatggatgctgctatgtttggagaaactgattatcttaatggcgtaagcgaaaat
gttatgcttgggcagcttgctccatatggaactgcatgctttgacgtcctaattgaccct
gataaacttagggatactgctactcatcttgaaattcatggagaatttgccaaactcggg
aaattctctacgctttctcaaacaacaagatcttattccgacagcggggcatttgaatcg
gattcttttgaatctccaatgtcgcctctttctccaatgtctccgctttaccaatcttat
gaaccaatgtcccctatgatttctggtcaattttctcctgttcaaatgactccaagatcg
ccaatgagtccagtttcaccaggagggatattcagcccagttccatattctcctatgagt
ccatcctcaccacttatggattacacaccaacttctcccatctatgcagcaagtagccca
acatacaatacagaggtttctgaaagggctagaaaaaagtataaggttaacaatacactt
agctcatactcaccatcttcaccattaaattcagacaacaaaataagtaacataagtcca
gatttatcaccaacatcaccgcattattcaccaacatctccacattattcaccaacatct
ccacattattcaccaacatcaccacactattcaccaacatcaccacattattcaccaacg
tcaccacattattcaccaacgtcaccacattattcaccaacgtcaccacattattcacca
acatcaccacattattcaccaacatctccacattattctccaacatcaccacattattcg
ccaacatctccacattattctccaacatcgcctcactactctcctacctcgccacattat
tcaccaacatcaccgcattactctccaacatcaccacactattctccatcatcaccgcat
tattctccaacttcgcctcaatactcacccacatcacccaactacaaccccgcatcgcca
aattattctcccacctcacactactctcctacctcgccaaattacaatcctacctctccg
aattattctccatcttcacccaattatatttcaaataactctggctctcctgggtactcg
ccatcgtcacctcaatatgatcctatagcggttgcttcagtccctagatctccatcgtat
tctgttggaaaaatggtagacgctgaatattcaccgtcttcccctctagacgaaacaaag
aattcataa

DBGET integrated database retrieval system