KEGG   Cryptosporidium parvum: cgd4_2560Help
Entry
cgd4_2560         CDS       T00168                                 

Definition
(RefSeq) phospholipase C, delta 1 ortholog with 2 EF hands plus phospholipase C domain plus C2 domain
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cpv  Cryptosporidium parvum
Pathway
cpv00562  Inositol phosphate metabolism
cpv01100  Metabolic pathways
cpv04070  Phosphatidylinositol signaling system
cpv04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    cgd4_2560
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    cgd4_2560
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    cgd4_2560
Enzymes [BR:cpv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     cgd4_2560
Membrane trafficking [BR:cpv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    cgd4_2560
 Endocytosis
  Macropinocytosis
   Phospholipase C
    cgd4_2560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 EF-hand_5 Mcp5_PH EF-hand_10 EF-hand_4 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 3372851
NCBI-ProteinID: XP_625844
ApiDB_CryptoDB: cgd4_2560
UniProt: Q5CR08
Position
4
AA seq 883 aa AA seqDB search
MFRPLLDCNGEISINRLLGSQDLSEYVISVRTFEDVVNKLNIVVSDRLMQLLHEVDVDIA
LDTCKSGSYLYKYPRSCIGSRRFSRYNFEIDLDSGCVKWYKKKKTLICSRKVVFIQTLYL
NDVNHILPGSDSDFWRSKKCTKKEYINSNFGIELVVIGKRNKTLRLLCANKEEWKFWMVG
LLVSHALAQREKLVSKIKGTKKIVDAKHFYTHDYIRRQWELSDLDNSGSISFTELMRLTK
RLQMPVSKDYTHALFCEYDNDNNGALDYKEFRNLLTQLLILPELRDLFDEYKDPDTNVMG
ANKFRNFLIDVQGMDPSNSLESLVNAVLNMKEPFIERGGITEIGFNILMSSEFNSAFDPL
KRDVYQSMDEPISHYWIASSHNTYLTGDQLTSKSEIGQYITVLLQGCRCVELDVWNGPDG
SPIIYHGHTLTSKVYFEDVIRACKDYAFQISPYPIILSLEMHASDKQREKVAEIILNVLG
DSLYIPPNDGSDRLPTPNELKYKFLVKAKVPKEDISFDLRAGVINEDDEKNDLNPDILEV
DLEVSNNTRIENEKQASSYNQNQTKRRLYSSLISLPGNAIQLSNFENRRRMSIGSLVETK
FLRLAKDSSMSLAKFHQDHLCRVYPSGTRISSSNYNPLIPWSYGAQIVALNYQAVGTALL
LNEGRFRQNGGSKSGYVLKPKMCLKKCFDGRVFDPMNPLETLELFDIPPVRVCIQILSAH
QLPDNLSQFSRGIAGLISGNKLSPYITISVFGGPSEEFKSYRTPVINNNGFNPKWENLSP
FTFNVLCPEISIINFEVKSSDSIQSEFIAAASIPVSCLRPGLRWIQLFDANFIDIQCCGI
LANISITTELPKTYMLSSILTGNNGSSSTNLQETLQQFRGIKF
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggccgttgttagactgtaatggagaaattagcattaatagattgctcggaagt
caagatctatccgaatatgtaatatccgttcgcacatttgaggatgtagtaaacaaattg
aatatagttgtaagtgacagactcatgcaattgcttcatgaagttgatgtagatattgca
ctagatacatgcaaaagtggctcttacctatataaatatccgcgttcttgtattggtagt
agacgcttttcaagatataactttgaaattgacttagattctggatgcgtaaagtggtat
aaaaaaaaaaaaactttgatttgttctagaaaagtggtatttattcagactttatatcta
aatgatgtaaaccacattcttccaggatctgatagtgacttttggaggtcaaagaaatgt
acaaagaaggagtatatcaattctaattttgggattgaactagtagtaataggaaaaaga
aataaaacactaagacttttatgcgcaaataaagaagaatggaaattttggatggtcggg
ctgttggtaagccatgctcttgctcaaagagagaagttagtctcaaaaattaaaggaaca
aaaaaaattgttgatgctaaacatttttacactcacgactacattaggcgtcaatgggaa
ctttcagatttagataactctggttcaataagcttcacagagttaatgcgtttaacaaag
agattgcagatgccggtatctaaagattatactcacgctctcttttgtgaatatgataat
gataataatggtgcacttgattataaggaatttagaaatttgttaactcagcttttaata
ctccctgagttgcgtgatttatttgatgaatataaggatccagatacaaatgttatgggt
gcgaataaatttcgtaattttctgatagatgttcaaggaatggatccgtcaaactcatta
gaatcactagttaatgctgtattaaatatgaaagaaccgttcattgaaaggggtggtatt
actgaaattgggttcaatattctaatgtcttcagaatttaactccgcatttgatccatta
aaaagagatgtatatcaatcaatggatgaacctatttcacactactggatagcttcgagc
cacaatacttatttaactggcgaccaactaacttcaaaatccgagattggacaatatata
actgtattacttcaaggatgtagatgtgtagagttggatgtttggaatggcccagatgga
tcaccaattatttaccatggccacactttaacatctaaagtttactttgaagatgtaatt
cgagcatgcaaagactatgctttccagatatctccatatccgattattttatcgcttgaa
atgcatgcatctgataaacaacgtgaaaaggttgcagaaataatattgaacgtattaggc
gattctctttatattcccccaaatgatgggagtgatagacttcccaccccaaatgaactt
aaatataaatttcttgtcaaagctaaggtcccaaaagaagatattagttttgatttaaga
gcaggggttattaatgaagatgatgaaaaaaatgatctaaacccagacatattagaagtt
gatctcgaagtgtccaacaatacaaggattgaaaatgaaaagcaagcctcgtcttacaat
caaaatcagactaagaggagattatattctagtctaatttcccttccaggaaatgcgata
caactgtctaattttgaaaatcgaagaagaatgagcattggttctcttgttgaaacaaaa
tttctgcgccttgcgaaagactcaagtatgagtcttgcaaagttccatcaagatcatcta
tgtagagtttatccatcaggtacacgtatatcgagttcaaactataatcctttaatacca
tggtcatacggagctcagattgtcgcattgaattaccaagcagttggaactgccttatta
ttgaatgaagggagattcagacaaaatggtggctcaaaaagtggctacgtactaaaacca
aaaatgtgcctaaaaaagtgctttgatggacgggtattcgatcctatgaaccctttagaa
actttagagctctttgatatccctcctgttagagtgtgtatccaaatactatcagctcac
cagctccctgacaatctatcgcagttctcacgtggaattgcaggcctaatatctgggaat
aaactttcaccatacattactatttctgtttttggagggcccagcgaagagttcaagtca
tacagaacgcctgtaataaataataatgggtttaatccaaaatgggaaaacttgtctcca
tttacattcaatgttctttgcccagaaatttcgattattaatttcgaggttaagtcatca
gattcgatacagtctgaatttattgcagcagcttcaattcctgtttcatgccttagacct
ggtttaaggtggatacaactatttgatgcaaattttattgatatccagtgttgtgggatc
cttgcgaacatttctataacaacagaattaccaaaaacgtatatgttatcatcaatttta
acaggaaacaatggaagctcatcaacaaatctacaagaaacattgcaacagtttagagga
attaaattttga

DBGET integrated database retrieval system